KEGG   Eutrema salsugineum: EUTSA_v10025559mgHelp
Entry
EUTSA_v10025559mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
eus  Eutrema salsugineum
Pathway
eus00941  Flavonoid biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Module
eus_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    EUTSA_v10025559mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     EUTSA_v10025559mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Motif
Other DBs
NCBI-GeneID: 18028597
NCBI-ProteinID: XP_006413609
UniProt: V4MIA4
Position
Unknown
AA seq 358 aa AA seqDB search
MVAVERVESLASSGIKSIPKEYIRPKEELESINDVFQEEKKEDGPQVPTIDLQDIESEDQ
KIREKCIEELKKAAMDWGVMHLVNHGVPVDLMERVKKTGEEFFGLPVEEKEKYANDQATG
KIQGYGSKLANNASGQLEWEDYFFHLVYPEDKRDLSLWPKTPSDYIEATSEYAKCLRLLA
TKVFKALSIGLGLESDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTF
ILHNMVPGLQLFYEGKWVIAKCVPDSIVMHIGDTLEILSNGKYKSILHRGLVNKEKVRVS
WAVFCEPPKDKIVLKPLPEMVSVESPAKFPPRTFAQHIEHKLFRNEQEELISEKKNQV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagtagaaagagttgagagtttagcctcaagcggaatcaaatcgatcccgaaa
gaatacattcgtcccaaagaagagctcgagagcatcaacgacgttttccaagaagagaag
aaagaagacggtcctcaagttcccaccatcgacctacaagacatcgagtcagaagatcaa
aagattcgtgagaaatgcattgaggaactgaaaaaggcagctatggattggggagtgatg
catttggtcaaccatggtgtaccggttgatctaatggagcgtgtgaagaaaaccggagaa
gagtttttcggtttacccgttgaagagaaggagaagtatgccaacgatcaagctacaggg
aagattcaagggtatggaagtaaattggctaacaacgcgagtggacaattggaatgggaa
gattatttctttcatcttgtttatcctgaagacaaaagagatctttcactttggcccaag
acaccaagtgattacatagaagcaacgagtgagtacgccaagtgtcttcgtttgctagca
acaaaagtcttcaaggcgctctctataggtctaggcttagagtctgaccgtctagagaaa
gaagtgggtggtttagaagagcttcttctacaaatgaagataaattattacccaaaatgc
cctcagcctgagctagcacttggcgtggaagctcacaccgatgtaagcgctctaaccttc
atcttacacaacatggttccaggtttgcagctgttctacgagggtaaatgggtcattgca
aaatgtgtccccgattcgattgtgatgcacattggagatactttggagattcttagtaat
ggcaagtataagagtatacttcatcgtgggttggtgaataaggagaaagttagggtatct
tgggctgtgttttgtgagccaccaaaggataagattgttcttaagccgttgccggagatg
gtgagtgttgagtctccggctaagtttcctccaaggacatttgctcaacatattgagcat
aagttgtttaggaacgaacaagaggaattgatatcagagaaaaaaaatcaagtttaa

DBGET integrated database retrieval system