KEGG   Eutrema salsugineum: EUTSA_v10025723mgHelp
Entry
EUTSA_v10025723mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K17744  L-galactose dehydrogenase [EC:1.1.1.316]
Organism
eus  Eutrema salsugineum
Pathway
eus00053  Ascorbate and aldarate metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Module
eus_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    EUTSA_v10025723mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.316  L-galactose 1-dehydrogenase
     EUTSA_v10025723mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red SLATT_1
Motif
Other DBs
NCBI-GeneID: 18029218
NCBI-ProteinID: XP_006412326
UniProt: V4MBJ5
Position
Unknown
AA seq 323 aa AA seqDB search
MSIPQAKLELRPLGKTGLNVSSVGFGASPLGSVFGPVAEDDAVATVRDAFRLGINFFDTS
PYYGGTLSEKMLGKALKALQVPRGDYIVATKCGRYKEGFDFSAERVRKSIDESLERLQLD
YVDILHCHDIEFGSLDQIVSETIPALQKLKQEGKTRFIGITGLPLHIFTYVLDRVPPGTI
DVILSYCHYGINDSTLLDLLPYLKSKGVGVISASPLAMGLLTEQGPPEWHPASPELKSAC
KAAVAHCKSKGKKITKLALQYSLANKEISSVLVGMSSVSQVEENVAAVTELEGLGMDQET
LSEVEAILEPVKNLTWPSGIDQK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattcctcaggcaaagttggagcttcggcctctgggaaagacagggctcaatgtt
agttccgttggttttggcgcttctcctctcggaagtgtcttcggtcctgtcgccgaagat
gatgccgtcgccaccgtgcgcgacgctttccggcttggcatcaacttcttcgacacctcc
ccgtattatggaggaacactttcggagaaaatgcttggtaaggcactcaaggctctacaa
gtccctagaggtgactacattgtggccaccaaatgtggacggtataaagaaggttttgat
ttcagtgctgagagagtaagaaagagcatcgacgagagcttggagaggcttcagctagat
tacgttgacatacttcactgccatgacattgagtttgggtctcttgatcagattgtgagt
gaaacaattcctgccctgcagaaactgaaacaggaagggaagacccggttcattggtatc
actggtcttcctttacatatttttacttatgttcttgatcgagtgcctccagggactatc
gatgtgatattatcctactgtcattacggcataaatgattcaactttactcgatttgcta
ccttacttgaagagcaaaggtgtgggtgtgattagtgcgtccccattggcaatgggtctc
cttacagaacaaggtcctcctgaatggcaccctgcttcccctgagctcaagtctgcatgc
aaagccgcagttgctcactgtaaatcaaagggtaagaagatcacaaagttagcactgcaa
tacagcttagcaaacaaggagatttcatcagtattggttggaatgagctctgtctcacag
gtggaagaaaatgttgcagcagttacagagcttgaaggtttggggatggatcaagaaact
ctgtctgaggttgaagctattctcgagcctgtaaagaatctgacatggccaagcggaatc
gatcagaagtaa

DBGET integrated database retrieval system