KEGG   Eutrema salsugineum: EUTSA_v10026209mgHelp
Entry
EUTSA_v10026209mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif
Pfam: NdhM DHOase
Motif
Other DBs
NCBI-GeneID: 18030084
NCBI-ProteinID: XP_006411836
UniProt: V4MA86
Position
Unknown
AA seq 217 aa AA seqDB search
MVASFSYTACTKLSLLHPPMAAQIRPIKTTQKAFVMTNPEQDSTLEEQETEIIKEEQTEK
KMKKQPTPLRPVEKQSNVKSTGMPREFGGQWLSSVTRHVRIYAAYIDPETCEFDQTQMDK
LTLILDPTEEFVWDDESCNKVYSYFQELVDHYEGAPLTEYTLRLIGSDVEHYIRKMLFDG
EIQYNMDARVLNFSMGKPRVQFNTSNIEVGGDGQPQE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggttgcatcattctcttacactgcttgcaccaagctttctctgttacatcctcccatg
gctgctcaaatccgaccaattaaaacaacacaaaaggcgttcgtgatgacgaatcctgaa
caagacagtacactcgaggaacaggaaacagagataataaaagaagagcaaactgagaag
aagatgaagaagcagccaacgccattgagaccagtggagaaacagtcaaatgtgaaaagc
acgggcatgccaagagagtttggtggtcagtggctaagcagcgtgacacgtcacgtcagg
atttatgctgcttatatcgatccagagacttgtgagtttgaccagacgcagatggataaa
ctcactttgattcttgatcctactgaagagtttgtgtgggatgatgaaagctgtaacaag
gtctattcttatttccaagaactcgttgatcactacgagggagcaccattaacggagtat
acattaagattgataggatcggacgtagagcattacataaggaagatgttgtttgatgga
gagatacaatacaatatggatgcaagagttcttaatttcagtatgggcaagcctcgtgtt
caattcaacaccagcaacattgaagttggtggagatggccagcctcaagaatag

DBGET integrated database retrieval system