KEGG   Eutrema salsugineum: EUTSA_v10027992mgHelp
Entry
EUTSA_v10027992mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K17434  large subunit ribosomal protein L53
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eus03011]
    EUTSA_v10027992mg
Ribosome [BR:eus03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EUTSA_v10027992mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 18022546
NCBI-ProteinID: XP_006405615
UniProt: V4M497
Position
Unknown
AA seq 127 aa AA seqDB search
MLKFLSKVRIEFNTLDPRLASCVEFLAQCNARKAKESNPNCQVMVKRRTDDQPPQITVTF
VNGVEEAFDAAATSAQSIRKMILDKGQYLETEQMFREAKEQWPVIIPEEEIHQQAPGVKP
RKAEDKK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagtttctatcaaaagtaagaatcgagttcaacacattggatccaagactcgcg
tcttgtgttgaattcttagctcaatgcaacgcgaggaaagccaaagagtcgaatccgaac
tgtcaggttatggtgaaacgtcgaacagacgatcagccaccgcagatcacagtcacgttc
gttaatggcgtcgaggaagctttcgacgcggcagcgacctcggctcagtcgataaggaag
atgattctcgataaaggtcagtatctcgagacagagcaaatgttccgtgaagccaaagag
caatggcctgtgatcattcctgaagaagagattcaccaacaggctcctggtgtcaagccg
agaaaagcagaagacaagaagtaa

DBGET integrated database retrieval system