KEGG   Eutrema salsugineum: EUTSA_v10028287mgHelp
Entry
EUTSA_v10028287mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
eus  Eutrema salsugineum
Pathway
eus03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EUTSA_v10028287mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eus03041]
    EUTSA_v10028287mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EUTSA_v10028287mg
Spliceosome [BR:eus03041]
 Complex C
  Other components
   Step II factors
    EUTSA_v10028287mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 DUF2075 ATPase PhoH AAA_16 ABC_tran Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 18022440
NCBI-ProteinID: XP_006405866
UniProt: V4LU10
Position
Unknown
AA seq 981 aa AA seqDB search
MENKELKKLNYLSLVSNVCNELETHLIRDAPKVLAEFIIHLGRHSETVDDFDKKLKEEDV
TEIPDYFLRSLLTVIHGIYPPKPKPKSEKKKKKKKKKREDVEDGDKGSFKALAIKDTKDK
VKELEKEMEREARQRQREENRNKSWDRERRRRGKRMSSPERWEVKQLIASGVLRMEEFPN
YDEEEGDGMVYQEEEEEEVEIEMNEEEPSFLKGQSRYSTVDMSPVKIFKNPEGSLSRAAA
LQSALTKERRETREQQQRTMVDSIPKDLNRPWEDPMPETGERHLAHELKGLGLSAYDIPE
WKKDAFGKTPTFGQRSKLSSIQEQRKSLPIYKLKKELIQAVQDNQVLVVIGETGSGKTTQ
VTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTV
IKYMTDGMLLREILIDENLSQYSVVMLDEAHERTIHTDVLFGLLKKLLKRRTDLRLIVTS
ATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTTQPESDYLDAALIIVLQIHLTEPEGDIL
LFLTGQEEIDYACQSLYERMQALGKNVPKLNILPVYSALPSEMQSRIFDPSSPGTRKVVV
ATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQRLESLVITPISQASAKQRAGRAGRTGPG
KCYRLYTKSAYSNEMLPTSTPEIQRIDLGMTTLTMKAMGINDLLSFDFMDPPKPQALISA
MEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKTLLASVELGCSDEILTVIAMIQTGNI
FYRPRNKQAEADQRRAKFFQPEGDHFTLLAVYEAWKANNFSGSWCIENFVQSRSLRRAQD
VRKQLLSIMDKFKLDVISAGKNLTKISKAITAGFFFHGARKDPQEGYRTLVENQPVYIHP
SGSLFQRQPDWVIYHELVMTTKEYMREVTVIDSKWLVELAPRFFKVADPTKMSKRKRLQR
IEPLYDRYHEPNSWRLSKRRA
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaggaactcaaaaaattgaactatctctctctcgtctccaatgtctgtaac
gaattagagacgcatcttataagagatgccccaaaggtgttggccgagttcatcatccat
cttggtcgtcactctgagactgtcgatgacttcgataagaagctcaaggaggaagacgtc
acagagattccggattatttccttcgctcgctgttaactgttatccacggtatttaccct
ccgaaacctaaacctaagtctgagaagaagaagaagaagaagaagaagaagagagaggat
gtagaagatggagataaaggaagtttcaaagctttggctattaaagatactaaggataaa
gttaaagagcttgagaaagagatggaaagagaagcgagacagagacaaagagaggagaat
cgaaataagagttgggatcgagaaagaagaagaagaggtaagagaatgagctcacctgag
agatgggaagtgaagcagttgattgcctctggtgtcttgagaatggaggagtttccaaat
tacgacgaggaggaaggagatgggatggtttatcaagaggaagaagaagaagaagttgag
attgagatgaatgaagaagaaccttctttcttaaagggccaaagcaggtacagtactgtt
gacatgtctccagtgaagatcttcaagaatccagaaggatcattgagccgagcagctgca
ttgcagtctgcactcacaaaggagaggagagaaacgagggagcagcagcaaagaacaatg
gttgactcaatccccaaggatctgaatcgtccttgggaagatccaatgcctgaaactggt
gaaaggcatcttgctcatgagcttaagggtttaggtttatcagcttacgacatacctgaa
tggaagaaggatgcttttggaaaaactccaacttttggtcaaagatcaaagctttcttca
atccaggagcaaaggaagagccttcctatatacaagttgaaaaaagagctgatacaagct
gtgcaagataatcaagttttggtagtcattggtgagactggctctgggaagacaacacag
gtgactcagtatctcgctgaagcaggttatacaacaaaaggaaagattggttgtactcaa
cctcggagagttgcagcgatgtctgtagccaagagagtagctgaggagtttggttgccgt
ttaggagaagaggtagggtatgcgattcggtttgaggattgtactggaccagatactgtg
atcaagtacatgactgatggtatgcttcttagagagattctgatagacgaaaacctctct
caatactctgttgtcatgcttgatgaagctcacgagcggacaatacacactgatgttctg
tttggtcttctaaagaagctgttgaaacgtagaaccgaccttcgtctgatagtcacgtca
gctacattggatgctgagaaattctctggctatttcttcaactgcaacatcttcacaatc
cctggaagaaccttccctgttgagatactgtatacaacacagccagagtctgattacttg
gatgcagctcttatcatagtccttcaaattcacttgactgagccggaaggtgacattctc
ctctttttaacaggacaggaagaaatcgattatgcatgtcagtcactgtacgagagaatg
caagccctaggtaaaaatgtacctaaactcaacatacttccagtttacagtgcccttcct
agtgaaatgcagtctaggatatttgatccttcatctcctggtacacggaaagtggttgta
gccacaaatattgcagaagcttctttgacaatagatgggatatattatgttgttgatcct
ggttttgcaaagcagaacgtgtataacccaaagcaaaggttagaatctctagtcataact
ccaatctcacaggcatcagcaaagcaaagagctggacgtgctggtcgtactggtccaggt
aaatgttaccgtctctacacgaagagcgcatatagtaacgagatgcttcctacatcaacc
cctgaaatacaaaggattgatcttggaatgacaacgcttaccatgaaagcaatgggcatc
aacgacttgctatcgtttgatttcatggatccaccaaaaccacaggctttgatatctgcc
atggaacagttgtatagcttgggggctttggatgaggaagggttgttgacaaagctaggt
agaaaaatggctgagtttcctcttgaaccaccgctctcaaaaacattgctggctagtgtg
gaactcggatgcagcgatgagattttaacggtgattgctatgatccagacgggcaacata
ttctatagaccgaggaataagcaagctgaagcagaccaaagaagggcaaagtttttccag
cctgaaggtgaccactttacattgctagctgtatatgaagcttggaaggccaacaacttc
tcaggatcatggtgtatcgaaaacttcgtacagtcacgatcgttaagacgtgctcaagat
gtgaggaaacagcttctcagcattatggacaagtttaaactagatgtgataagcgcggga
aagaatcttacaaagataagcaaagcaatcacagcaggattcttcttccatggagcaaga
aaagatccacaggaaggttacaggacgctagtggagaaccaaccggtttatatacatccg
agcggctcgctgttccagagacaaccagattgggtgatatatcatgaacttgtgatgacg
accaaagagtacatgagagaagtgactgtgattgactcaaagtggcttgttgagttagct
ccaagattcttcaaagtcgctgatccaaccaaaatgagcaagcgtaagcgcctgcaacgg
attgagcctttgtatgatcgttatcacgagcctaactcatggcgtctcagcaaaagacgt
gcttaa

DBGET integrated database retrieval system