KEGG   Eubacterium sulci: ADJ67_00780
Entry
ADJ67_00780       CDS       T04038                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
euu  Eubacterium sulci
Pathway
euu00472  D-Arginine and D-ornithine metabolism
euu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:euu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ADJ67_00780
Enzymes [BR:euu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     ADJ67_00780
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: AKT46384
UniProt: X8K2M8
Position
171452..171817
AA seq 121 aa
MIREDDFQERRKHIANLTDEELYERFWQLTEQVVNPLLELGKKNTTPSVERAVLLRMGIS
SLETQKIVQGCMDNGLMGHGAGHVVYKISKEKNITIPEAGTALANGEYWTDAVALFKKGG
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgataagagaagacgattttcaagaaagaagaaaacatatagctaatcttactgacgaa
gaactatatgagagattctggcagcttacagaacaggtagtaaatcctcttttggagctt
ggaaagaagaacacaacaccttcagttgagagagctgtactcctaagaatgggaatttca
tcactcgagacacagaagattgtacagggttgcatggacaacggactaatgggccacggc
gcaggtcacgttgtttacaagatttcaaaagaaaagaacattactattcctgaagcaggc
acagcattagcaaacggtgaatactggacagatgctgttgctctctttaagaaagggggc
aaataa

DBGET integrated database retrieval system