KEGG   Eubacterium sulci: ADJ67_00785
Entry
ADJ67_00785       CDS       T04038                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
euu  Eubacterium sulci
Pathway
euu00472  D-Arginine and D-ornithine metabolism
euu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:euu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ADJ67_00785
Enzymes [BR:euu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     ADJ67_00785
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AKT46385
UniProt: X8K2D3
Position
171820..174075
AA seq 751 aa
MSDMILKHNEKIDVREIIKDLDKYEPRRRGWHWREPAPNLELGPFVYKDCSKPLKNSVGL
PPAKFFGDIDPQPLPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRHMGQSHIDGLME
GTPQGIGGIPVTRKQVRAQRKALDLIEDEVGRPINYHSYVSGVAGPDVAVMFAEEGINGA
HQDPQYNVLYRDINCVRSFVDACESKKIMAWADILQIDGAHNANATAREAWKVMPELIVQ
HSINSLFSEKVGIKPSNISLSTVPPTATPAPCMYLDLPYAVALRDICDRYKMRAQQNTKY
ICSSVREATVTHVLNMFISKLTRADIQSTITPDEGRNVPWHIYNMEACDNAKQALIGMDG
LMELVELKKDGPLREMVRDIKERALLFMEEIIEVGGYFQAVQEGFFVDSAKYPARNGDGI
ARQIEGGVGYGFIFEREEDYMAPVTAHYGYNNVEQYGGDPENPSALIGGCTFEDRSKIVF
IDELEEEDTVHRRLEKVEKYLDGEAIKPEMEWCGDGVVLMTMMIPANARTSEAVALEIGR
KLGLENPEVTSKEVMQEAEGTRIEMKGKVTFDVDPEGLEIPPEPHHLPDAILFEEFKEHP
MVVVCGTVGEDEHSVGLREIINIKHGGIEKWGIKVNYLGTSVPVEKLVDAAIELNASAIL
ASTIISHDNIHYKNMKRINELAIEKGIRDKVIICAGGTQVVPEEARKTGIDEGFGRDSHG
IDVATFLAEEAMRKRGVLAPGEKANEKFGKK
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgtcagatatgattttaaagcataacgaaaaaatcgacgttagagagattatcaaggat
cttgataagtatgagccaagaagaagaggatggcactggcgtgaaccagctccaaaccta
gagctaggaccttttgtatataaggattgctcaaagccactaaagaacagtgttggtctt
ccaccagctaagttctttggagatatcgatccacagccacttccagtaatcacaacagaa
atcgcttctggtagattcgaagatgatatcagaagaatgagaatggctgcatggcacggc
gctgaccatatcatggtaatcagacatatgggtcagtcacatatcgatggccttatggag
ggtactccacagggtatcggtggcattcctgtaacaagaaaacaggttagagcacagaga
aaggctcttgacttaattgaggatgaagtaggtcgtccaattaactaccactcatacgta
tcaggtgtagcaggaccagatgtagcggtaatgttcgctgaagaaggtatcaacggtgct
caccaggatccacagtacaacgttctttacagagatatcaactgtgttagatcatttgtt
gacgcttgtgaatcaaagaagattatggcttgggctgacattcttcagattgacggcgct
cacaatgctaacgcaacagcaagagaagcttggaaggtaatgcctgagctaatcgttcag
cactcaatcaactcactcttctcagagaaggttggtattaagccaagcaatatctcactg
tcaacagtacctccaacagcaacaccagctccttgtatgtaccttgacttaccatacgct
gtagcacttagagatatctgcgacagatataagatgagagctcagcagaacacaaagtat
atctgctcatcagtaagagaagctactgtaacacacgtgctaaacatgttcatttcaaag
cttacacgtgctgacatccagtcaacaatcacacctgatgaaggaagaaacgttccatgg
cacatctacaacatggaagcttgcgacaacgctaaacaggcactcatcggtatggacgga
cttatggaactcgtagagctcaagaaggacggtccactcagagagatggttagagacatc
aaggaaagagcactcctattcatggaagaaatcatcgaagttggtggatacttccaggct
gtacaggaaggcttcttcgtagactcagctaagtacccagcaagaaacggcgacggtatc
gcaagacagattgaaggcggtgtaggctacggatttatctttgagagagaagaagactac
atggctccagtaacagctcactacggatacaacaacgttgagcagtacggaggagatcct
gaaaatccatcagctcttatcggtggttgtacattcgaagacagaagcaaaatcgtattt
atcgatgagctcgaagaagaagatacagtacatcgcagactcgaaaaggttgagaaatac
cttgacggagaagcaatcaagccagagatggaatggtgcggagacggcgttgtactcatg
acaatgatgattccagcaaatgcaagaacatccgaagctgttgctctagagattggtcgc
aagctaggccttgagaatcctgaagtaacaagtaaggaagtaatgcaggaggctgaaggt
acaagaatcgagatgaagggtaaggttacattcgatgtagaccctgaaggacttgagatt
ccacctgaaccacatcacctaccagatgcaattctatttgaggagttcaaggaacaccca
atggtagttgtttgcggaacagtaggtgaggatgaacactcagttggactaagagaaatc
atcaacatcaagcacggtggtatcgagaagtggggtatcaaggttaactacctaggaact
tcagtaccagttgaaaagcttgttgacgctgctatagagcttaacgcttcagcaatccta
gcttcaacaatcatttcacacgataacatccactacaagaacatgaagagaatcaacgaa
ctcgcaatcgagaagggtatcagagataaggtaattatctgtgctggcggaactcaggtt
gttcctgaagaagctagaaagactggtatcgacgaaggtttcggaagagactcacatggt
atcgatgttgcgacattccttgcagaagaagcaatgagaaagaggggcgtactagctcca
ggcgaaaaggccaacgaaaagttcggtaaaaaatag

DBGET integrated database retrieval system