KEGG   Eubacterium sulci: ADJ67_06775Help
Entry
ADJ67_06775       CDS       T04038                                 

Definition
(GenBank) hypothetical protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
euu  Eubacterium sulci
Pathway
euu00670  One carbon pool by folate
euu01100  Metabolic pathways
euu01120  Microbial metabolism in diverse environments
euu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:euu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ADJ67_06775
Enzymes [BR:euu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ADJ67_06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AKT47365
UniProt: X8K6H3
Position
complement(1463914..1464768)
Genome map
AA seq 284 aa AA seqDB search
MKISDIIKEKGFAASLEVFPPKNDLNIDTAIPLLDELSTLKPDFISVTCGAGGTIQSDNT
AKLCAHIKENYDTEPVAHFTCITSTKQQVADRLALLKEKGIENVLALRGDRPIEGLSISP
EYTYAKELIKEIKAEDFCVAAACYPESHIDCGDLDAEIEHTKQKVEAGASFLISQLSFSS
DIFLNYLSKLRNAGVDAPFLAGIMPILSKAQVERMIYMCGVSLPGNIVRILAKYQDNKED
LEKAGIEYACSQIETLKKEGVDGIHIYTMNKPHIAKALMQAARQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcagacattataaaagaaaaaggcttcgcggcatcactagaggtgtttccg
ccgaagaacgatttaaacatagatactgcaattccgcttttagatgagctaagcacacta
aagccagatttcataagtgtaacctgtggtgctggtggaactatacagtcagacaataca
gcaaagctttgcgcacatataaaggaaaactatgacacagaaccagttgctcactttaca
tgtataacatcaacaaagcagcaggttgcagatcgtctagcacttcttaaggaaaagggt
atcgaaaacgtacttgctttgcgtggtgatagacctatcgagggactatcaattagccca
gagtacacatacgctaaagagctgatcaaagaaattaaggctgaggacttctgcgtagca
gctgcctgttatccagaatcacatatagactgcggtgacctagatgcagaaatcgagcat
acaaagcagaaggttgaggcaggtgcgagctttttgataagccagctgagcttctcttca
gatatcttccttaactatctatcaaagctaagaaatgcaggagtagatgcaccattcctt
gcaggaataatgcctattctaagcaaagcgcaggtagagcgtatgatctatatgtgcggt
gtatcgcttcctggaaacatagttcgtatacttgcaaagtatcaggataacaaagaggat
ctagagaaggccggcatcgaatacgcatgcagtcagattgaaactctcaagaaagagggc
gttgacggaatacacatttacacaatgaacaagccgcatattgcgaaggcgctcatgcag
gcagctagacaatga

DBGET integrated database retrieval system