KEGG   Eubacterium sulci: ADJ67_07405Help
Entry
ADJ67_07405       CDS       T04038                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
euu  Eubacterium sulci
Pathway
euu00071  Fatty acid degradation
euu00280  Valine, leucine and isoleucine degradation
euu00310  Lysine degradation
euu00362  Benzoate degradation
euu00380  Tryptophan metabolism
euu00620  Pyruvate metabolism
euu00630  Glyoxylate and dicarboxylate metabolism
euu00640  Propanoate metabolism
euu00650  Butanoate metabolism
euu00900  Terpenoid backbone biosynthesis
euu01100  Metabolic pathways
euu01110  Biosynthesis of secondary metabolites
euu01120  Microbial metabolism in diverse environments
euu01130  Biosynthesis of antibiotics
euu01200  Carbon metabolism
euu01212  Fatty acid metabolism
euu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:euu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ADJ67_07405
   00630 Glyoxylate and dicarboxylate metabolism
    ADJ67_07405
   00640 Propanoate metabolism
    ADJ67_07405
   00650 Butanoate metabolism
    ADJ67_07405
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ADJ67_07405
   00072 Synthesis and degradation of ketone bodies
    ADJ67_07405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ADJ67_07405
   00310 Lysine degradation
    ADJ67_07405
   00380 Tryptophan metabolism
    ADJ67_07405
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ADJ67_07405
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ADJ67_07405
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ADJ67_07405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:euu04147]
    ADJ67_07405
Enzymes [BR:euu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ADJ67_07405
Exosome [BR:euu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ADJ67_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C gag-asp_proteas Asp_protease_2 ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKT47465
UniProt: X8K2P5
Position
complement(1585359..1586543)
Genome map
AA seq 394 aa AA seqDB search
MREVVIVSAVRTAIGGYGGTLKNVSARELGAVVIKGALEKAGVKPEMVDEVIMGNVLQAG
LGQNVARQMMLDAGLPKEVPAMTINKVCGSGLRAVELAAQIIKAEDADIIVAGGAENMSL
APYVVPSARWGARMFDTKMVDAMVNDGLWDAFNNYHMGVTAENVAEEWGLTREQMDQFAL
DSQLKAEAAVKSGRFKDEIVPVEIPQKKGDPIVFDTDEHPKFGSTIEKLGKLKPAFKKDG
RGVTAGNASGINDSGAAVVVMSADKAKELGLTPLVKIVSYASAGVDPKIMGIGPVPSSRK
ALEKAGLSINDMDLIEANEAFAAQALAVGKDLGIDPAKLNVNGGAIALGHPIGASGCRIL
VTLIHEMLKREDAKKGLATLCIGGGMGTALVVEK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgtaatcgtaagcgcagttagaacagctattggtggctatggtggaaca
cttaagaatgtttcagctagagagctaggagcagttgttataaagggagcactagaaaag
gctggagttaagccagagatggttgacgaagttatcatgggtaacgttcttcaggctggt
cttggacagaacgtagcaagacagatgatgctagatgctggtcttccaaaggaagttcct
gcaatgacaatcaacaaggtttgcggaagcggactaagagctgttgagcttgctgctcag
atcatcaaggcagaagacgctgacatcatcgttgcaggtggtgcagagaatatgtcacta
gctccatatgtagttccatcagcaagatggggagcaagaatgttcgacacaaagatggtt
gacgcaatggttaacgatggactttgggacgcattcaacaactatcacatgggtgtaaca
gctgagaacgtagctgaagaatggggtctaacaagagaacagatggatcagtttgctctt
gattcacagctaaaggctgaagctgctgttaagtcaggcagattcaaggatgaaatcgtt
ccagtagaaatcccacagaagaagggtgatcctatcgtattcgatacagatgagcaccct
aagttcggttcaacaatcgaaaagcttggcaagctaaagccagcattcaagaaggacgga
agaggagttacagctggtaatgcatcaggaatcaacgattcaggcgctgctgtagtagta
atgtcagctgacaaggctaaggagcttggcctaacaccactagtaaagatcgtttcatac
gcatctgctggtgttgatcctaagatcatgggaatcggacctgttccatcatcaagaaag
gctcttgagaaggctggactatcaatcaatgatatggatcttatcgaagctaacgaagca
tttgcagctcaggctctagcagttggtaaggacctaggaattgatcctgctaagctaaac
gttaacggtggagctatcgcacttggtcacccaatcggagcatcaggatgccgtatccta
gttacattgattcacgagatgctaaagagagaagatgctaagaagggtcttgctacactt
tgcatcggtggcggaatgggaacagctctagtagtagagaaatag

DBGET integrated database retrieval system