KEGG   Euzebya sp. DY32-46: DVS28_a3892Help
Entry
DVS28_a3892       CDS       T05999                                 

Definition
(GenBank) hypothetical protein
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
euz  Euzebya sp. DY32-46
Pathway
euz00340  Histidine metabolism
euz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:euz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DVS28_a3892
Enzymes [BR:euz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     DVS28_a3892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6
Motif
Other DBs
NCBI-ProteinID: AXV08564
UniProt: A0A346Y267
Position
4452625..4453392
Genome map
AA seq 255 aa AA seqDB search
MCRLAARTGPSAPLSSLLYDPPRSLEVLAYDPREQQSGHVNVDGTGVAWFDDADPAPLSY
RSIQPPWSDPNLPVLSRRLTSTVILAAVRSTTPGLPQGPSFVHPFTSGGLAGTHNGWIAD
FRATVARPLMAELSDRAFAELPGPSDTAVLFGLAADAHRGGASVLEAAEEATARTAKACR
SLGVTATLTLVLADRTGVAAVNAAVDRPANSLYVATDPDGAHLLASEPLDPALDWRPVAE
GTRAHLTPTSLEIHP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgcctcgctgctcggaccggaccgtccgcgccactctcgagcctgctgtacgac
cctcctcggtcgctggaggtcctggcttacgacccacgcgagcagcagtcgggccacgtc
aacgtcgacggcaccggggtcgcctggttcgacgacgccgaccccgcgcccctgtcctat
cgcagcatccagcctccgtggtcggaccccaacctgcccgtcctgtcgcgccgcctgacc
agcacggtgatcctcgccgcggtcaggtcgaccacacccggcctgccgcagggcccgtcc
ttcgtgcaccccttcaccagcggtggcctggcaggcacccacaacggctggatcgccgac
ttccgggcgaccgtcgcccggccgctgatggcggagctgtcggaccgggcgttcgccgag
ctccccgggccgagcgacaccgcggtgctgttcggcctggccgctgacgcccaccggggc
ggcgcctcggtgctggaggccgcggaggaggcaacggcgcggaccgcgaaggcctgccgc
tcgctcggggtcaccgccaccctgaccctcgtgctcgccgaccggaccggcgtcgccgcc
gtcaacgccgcggtcgaccggcccgccaactccctgtacgtggccaccgaccccgacggc
gcccacctgctggccagcgaacccctcgaccccgccctcgactggcgtcccgttgccgag
ggcacccgagcccacctgacccccacgagcctggagatccacccgtga

DBGET integrated database retrieval system