KEGG   Echinicola vietnamensis: Echvi_2640Help
Entry
Echvi_2640        CDS       T02388                                 

Definition
(GenBank) haloacid dehalogenase superfamily protein, subfamily IA, variant 3 with third motif having DD or ED
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
evi  Echinicola vietnamensis
Pathway
evi00010  Glycolysis / Gluconeogenesis
evi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Echvi_2640
Enzymes [BR:evi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Echvi_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AGA78882
UniProt: L0FZZ8
Position
complement(3130297..3130929)
Genome map
AA seq 210 aa AA seqDB search
MKIDKNIDFFVFDLVGVIIDLDIPFTVNQLGKLLESNGNHQSIDFMAHPVHHAFEKGEIS
DVVFRNEIRKTFNQQWSDQEIDQIWNGMLKNIPLQKIKLLKDLRKTHPVYMLSNTNSIHF
KRVEEILLADTGETSFSGLFDHLFLSHEMGCRKPDTVIYEKVLEKIGMPAEKGVFFDDTA
PNLIGAEKVGLRTVHINHPNALMDYFSDVH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagataaaaacatcgatttttttgtatttgaccttgtaggtgtcatcattgac
ttggacattccctttaccgtcaaccaattaggaaagttactggaaagcaatggtaaccat
cagtctatagacttcatggcacacccagtgcaccacgcttttgagaagggagagattagc
gatgttgtctttaggaatgaaatcagaaaaacgtttaaccaacaatggtctgatcaggaa
atcgatcaaatttggaatggaatgctgaaaaacatcccgctacaaaaaatcaagctccta
aaagacctccgaaagacacatccggtgtacatgctctccaataccaatagtatccacttc
aaaagggtggaggaaattttgctggcagacacgggagaaacaagcttctctggactattc
gaccacctttttttaagccatgaaatgggctgccgaaaaccggacacagtcatttatgaa
aaagtgctggaaaaaatagggatgccagccgaaaaaggtgtatttttcgatgatacggct
cccaacttaattggagccgaaaaagtggggctgcgcacagtccatatcaatcacccaaat
gcattaatggattatttctcggatgtacactaa

DBGET integrated database retrieval system