KEGG   Echinicola vietnamensis: Echvi_2662Help
Entry
Echvi_2662        CDS       T02388                                 

Definition
(GenBank) beta-1,4-xylanase
Organism
evi  Echinicola vietnamensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 CBM_4_9
Motif
Other DBs
NCBI-ProteinID: AGA78902
UniProt: L0G017
Position
3156654..3158792
Genome map
AA seq 712 aa AA seqDB search
MKTRYINILGILALGLGTSCVDYVPTDEYQVEKPESIALQEELNAYLPLKSYVDSIAHPD
FILGGAVSQSEYADKGVMYRLINSNFNEITAGYGMKHGAVVQADGSLLLDGVNAMYEAAA
AAGTSIYGHTLCWHANQNAGYLNGLLEPLVVNSPAFANELDLSPALEGDLSGWDTQGEVA
IAQNEGMGTGTPAFKLSAGESVSEPSNLQLVTPEMTIVPGNEYEIVAYVKSDIPAEGRIS
FEGLENNEPEMDWMSTGEISATFQTSMSWKEIRIRVNDFQGETFKIKFDLGYTPGATTYL
DINNLYVFDPNGEPMINNLVVDGDFEAGTGWGGWGNGSTRGITEDGMGFGGEGKAFFVTN
PSVTGGFWEVQTSYEFAEPLENGEAYKLSFWVKGDAEGIIRPELQSPDYSSNGYGQVMVT
KEWQQVELTTTATADDRSRLIFSYGEFAGTVYIDNVVLSSASFSGGSTTLVQKTPEEKEA
IISGELERWIAEMVTNSKAHVKAWDVVNEPMDDGNPHELKTGIGKTDMASDEFYWQDYVG
KDYAVKAFQWAREYGNPDDLHFINDYNLEYNLDKCQGIIDYVAYLESQGAQVDGIGTQMH
IGIDSNKQNIAKMFEMLAATGKLIKVSELDVRVNSSTPTAEILQQQSEMYKYVVDMYLQY
VPESQRYGITVWGITDSPDDANWLPGEHQGLWDLDLNRKPAYVGFVEGIQGL
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagatatatcaatatactgggaatactcgctctggggctcggtacatcttgt
gtggactatgtgcccacagatgaataccaagtggaaaaacctgaaagtattgccctgcag
gaggaattgaatgcgtatttgcctctaaagtcctatgtggacagtattgcccatcctgat
tttatccttggtggagcagtaagccagtccgaatatgcggataagggagtcatgtaccgc
ttgatcaacagtaatttcaatgaaatcacggccggctatggtatgaaacatggagctgtc
gtacaagcagatggcagccttttactggatggagtaaacgctatgtacgaagctgcagca
gcggcgggaaccagcatttatggtcacacgctctgttggcatgccaatcaaaatgcgggg
tacttgaatggtttgctggaaccgctcgtggtcaattcccctgcttttgccaatgaactg
gacctttcgccagcgttggaaggtgacctttccggatgggatacccaaggggaagtggct
atcgcccaaaatgaaggaatgggaacgggaacgcctgcctttaagctaagcgcaggggag
agcgtttcggagccttcaaacctgcaactggtcacccctgaaatgaccattgtccctgga
aatgaatacgagatcgtggcctatgtcaaatctgatatacctgcagagggaagaatcagc
tttgaaggcttggagaacaacgagcctgaaatggattggatgtccaccggtgagatctcg
gcgacttttcagacttccatgtcttggaaagagattcggattagggtaaacgatttccaa
ggggaaaccttcaagatcaaatttgacctaggctatacgcccggtgccaccacctacctg
gatatcaataacctgtatgtctttgaccccaatggagaaccaatgatcaataaccttgtc
gtggacggggattttgaggcaggtaccggctggggcggctggggcaatggctccacccgt
ggcattacagaggacggaatgggttttggtggagaaggaaaggcctttttcgtgaccaat
ccatcggtgactggcggtttctgggaagtgcagacctcctatgagtttgctgagccactg
gaaaatggcgaagcttacaaattgtccttctgggtaaaaggtgatgccgagggcatcatc
cgtcctgagctccagagtccggattattcctccaatggttatggccaggtgatggtgacg
aaggaatggcagcaggtggagctcactacgacggccactgctgatgatagaagccggttg
atctttagttatggagaatttgccggcacagtttacatcgataatgtggtcctgagcagt
gcctctttttccggtggttctaccacgctggtacaaaagacacctgaggaaaaagaagcc
atcatttcaggtgaacttgagcgctggatagccgaaatggtgaccaacagtaaagcacat
gtaaaagcttgggatgtggtgaacgaacccatggatgacggtaatcctcacgaactgaaa
acgggcattggcaagaccgatatggcatcagatgaattttactggcaggactatgtgggc
aaagattacgcggtcaaagccttccaatgggccagggaatatggaaatcccgatgacctt
cattttatcaatgactataacctggaatacaacctggacaagtgtcagggcattatcgac
tatgtggcctatctggaaagccaaggcgcgcaagtggacggcatcggtacacagatgcat
atcggcattgattccaacaagcaaaatattgccaagatgttcgaaatgctggcggccacg
ggcaagctgattaaggtctccgagctggacgtaagggtcaatagctccacaccgaccgcg
gaaatcctccaacagcaatctgaaatgtacaaatacgtggtggacatgtacctgcaatac
gtgccggaatcgcaacggtacggcatcacagtctggggcattaccgacagtccggatgat
gccaattggctgccgggagaacaccaggggctttgggaccttgacctcaataggaaacca
gcttatgttggttttgtggagggaattcagggattgtaa

DBGET integrated database retrieval system