KEGG   Echinicola vietnamensis: Echvi_3374Help
Entry
Echvi_3374        CDS       T02388                                 

Definition
(GenBank) 23S RNA-specific pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
evi  Echinicola vietnamensis
Brite
KEGG Orthology (KO) [BR:evi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:evi03016]
    Echvi_3374
Enzymes [BR:evi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Echvi_3374
Transfer RNA biogenesis [BR:evi03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Echvi_3374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DNAJ_related ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: AGA79595
UniProt: L0G447
Position
complement(3980851..3981558)
Genome map
AA seq 235 aa AA seqDB search
MTELEILFEDEHYIAVNKPAGVMVHRSSIAKDDDPIYAMQVLRDQMGHHVYPLHRIDRPT
SGVLWFARNPDVVPAFQEQFINQNIRKSYLTVVRGYTKEAKGIIDYPLRKNLKKELQEAQ
TEYERIGQVEIPFQSSPRHDTSRYSLVRAHPLTGRMHQIRRHLAHERNYIIGDNTHGDNR
QNRFFRMHFHMHHMLLHARSTAFDHPITGAPVLVTAPLPDYFEKIVTTFGWKSLV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacttgaaatcctctttgaagacgaacattacatcgccgtaaacaagcccgct
ggcgttatggtccaccgttccagtattgcaaaagacgatgacccgatatatgccatgcaa
gtactgcgagaccaaatgggacatcatgtttatccactccaccgaatcgatcggcctacc
tcaggagtattgtggtttgcccgaaaccccgacgtggttccggcctttcaggagcaattt
atcaaccagaacatccgaaaatcctacctcactgtagttcggggctataccaaagaggct
aagggcatcatcgattatcccttgcgcaaaaacctcaaaaaggaactccaggaagcgcaa
acggaatatgaacggattggccaagtggagatacctttccaaagctccccacgtcatgac
accagccgttattcgctcgttcgggcgcaccccctgaccggacgtatgcaccaaatcaga
cgacaccttgcgcatgagcgaaactacatcatcggcgacaacacccatggggacaaccgt
caaaaccggtttttcagaatgcactttcacatgcaccacatgctcttgcatgctcggtcc
accgcctttgatcacccgatcaccggtgcacctgtactggtgacggcgcccctacccgat
tactttgaaaaaatcgtcaccacatttggttggaaatccctggtttaa

DBGET integrated database retrieval system