KEGG   Echinicola vietnamensis: Echvi_3798Help
Entry
Echvi_3798        CDS       T02388                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
evi  Echinicola vietnamensis
Pathway
evi00051  Fructose and mannose metabolism
evi00520  Amino sugar and nucleotide sugar metabolism
evi01100  Metabolic pathways
evi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:evi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Echvi_3798
   00520 Amino sugar and nucleotide sugar metabolism
    Echvi_3798
Enzymes [BR:evi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Echvi_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AGA80010
UniProt: L0G5B4
Position
complement(4532251..4533252)
Genome map
AA seq 333 aa AA seqDB search
MSKIVNVVLSGGVGSRLWPLSRKSRPKQYLPIFDGETLFQKTVARNRSIADEVLVVGNKD
NYELSRKDMAASKLSQYRELVEACPRNTAAAIAFSAFHCHEEDVLFVTPSDHLITPGTAY
QTAVKRAIQLANEGNIVTFGLKPSHPETGYGYIEAVGEDVKDFHEKPEQEKADNFFKQGG
YLWNSGMFCFQAGVFLAELRRYETEIFDQAYGAYMLKKEIFLPETESLRIPSLSVDYAVM
ERSKKIKVVAADFEWSDMGSFEAIYDYLGKKGHHLDDSGNMVIGTNTHIEFTGLTNTLLI
FTKDAVLALKKENSQEVKDVFQRLENERPELVM
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcgtgaacgtagtgctttcagggggcgtgggcagtcggttgtggccactc
tccaggaagagtcgtcccaagcaatatttaccgattttcgacggggaaaccttgtttcaa
aagacagtggccagaaaccgatcgatagccgatgaagtactggtggtaggcaataaggat
aactatgaattgtccaggaaagacatggctgccagcaagctgagccaatacagggaactg
gtggaagcctgccccagaaataccgctgctgccatcgcattttctgcttttcactgccat
gaggaagatgtgctttttgtgactccatcagatcacctcataacacctggcacggcttac
caaaccgccgtaaaacgggccatacagctggccaatgaaggaaacatcgtaacgtttggg
ttaaagcctagccatccagaaaccgggtatggttacatcgaagcggttggggaggatgtt
aaagacttccatgaaaaacccgaacaggaaaaggcggataatttctttaaacaaggagga
tatttgtggaattcaggcatgttttgcttccaagcaggggttttccttgccgaattgaga
aggtatgaaacggagattttcgatcaggcctatggggcatatatgcttaagaaggagatt
tttctgccagaaaccgaatccctgcgcattccgtcactttcggtggattatgccgtgatg
gagcgatccaaaaaaatcaaggtggtagcagccgattttgagtggtccgatatgggatca
ttcgaggcgatttacgattaccttggcaaaaaggggcaccacctggatgactccggaaac
atggtcatcggaaccaacacccatatcgaatttacaggcttgaccaatacgcttttgatc
tttaccaaagatgccgtgctggccctgaaaaaggaaaattcacaagaagtcaaggacgtg
ttccagcgacttgaaaacgaacggccggaactggtcatgtga

DBGET integrated database retrieval system