KEGG   Echinicola vietnamensis: Echvi_3886Help
Entry
Echvi_3886        CDS       T02388                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
evi  Echinicola vietnamensis
Pathway
evi00010  Glycolysis / Gluconeogenesis
evi00020  Citrate cycle (TCA cycle)
evi00620  Pyruvate metabolism
evi01100  Metabolic pathways
evi01110  Biosynthesis of secondary metabolites
evi01120  Microbial metabolism in diverse environments
evi01130  Biosynthesis of antibiotics
evi01200  Carbon metabolism
Module
evi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Echvi_3886
   00020 Citrate cycle (TCA cycle)
    Echvi_3886
   00620 Pyruvate metabolism
    Echvi_3886
Enzymes [BR:evi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Echvi_3886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AGA80098
UniProt: L0G469
Position
complement(4643680..4645323)
Genome map
AA seq 547 aa AA seqDB search
MSDTMEEGVIAAWLKKVGDDVKAGDILAEVETDKATMELESYDEGVLLHIGVEEKDAVPV
NGVIAIIGEKGEDIDDLLKDLDGGGSGDADAAKSEAPAEDKKEESSSEADPSEEIDTSDI
NANLITMPKMSDTMQEGTIASWLKKEGDEVKSGDILAEVETDKATMELESYDDGVLLHIG
VQEGDSVPIDGVIAVIGEKGADYEKLLKAHEQKSNGGSDEKPAAKEEEKKEAPKEASKPA
PKKEETAKQTTSSSSASSDNGRIKASPLAKKLAEDKGVDIALIKGSGEGGRIIKRDVESF
DPASVQPAAQSGVAAPAAVGQESYTEEKVSQMRKTIAKRLAESKFSAPHFYLTMEINMDK
AIEARKSMNEIAPVKISFNDMVIKAVAASLKQHPKVNSSWLGDKIRYNEHVHIGMAVAVE
EGLLVPVIRFADSKTLSQISQEAKTLGGKAKNKELQPKDWEGNTFTISNLGMFGIEEFTA
IVNPPDACILAVGGIKETVIVKDGQMQVGNVMKVTLSCDHRVVDGAVGSGFLKTLKGLLE
DPVRILI
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccatggaagaaggggtgatcgcagcttggttaaagaaagtaggagacgat
gtaaaagccggggacatcttggcagaagtggaaaccgacaaagctaccatggagctggag
tcttatgatgaaggggtgttattgcacattggagtggaagagaaagacgctgtcccagta
aatggagtaatcgctattatcggtgaaaaaggagaagacatcgatgacttgctcaaagat
ctagatggtggaggcagcggagatgccgatgctgctaaatcggaagctcctgcagaagat
aaaaaagaagaaagcagcagtgaagcggatccttcagaagaaattgacacatccgatatc
aatgccaacctgatcaccatgcctaaaatgagtgataccatgcaggaaggtaccattgcc
tcttggttgaaaaaagaaggcgatgaagtgaaatcaggcgatatcttggcagaagtggaa
accgataaggctaccatggagctggaatcttatgatgacggcgtattgctgcatatcggt
gttcaggaaggagatagcgtgccgatcgatggcgtgatcgcggtgatcggggagaaaggt
gccgattacgaaaaactgctcaaagcgcacgaacaaaaatccaatggtggcagtgacgaa
aaacctgcagccaaggaagaagaaaagaaagaagctccaaaagaagcatccaaaccagca
ccgaagaaagaggaaactgcaaagcagaccacttcttcaagcagtgcttcttccgacaat
ggcagaatcaaagcttctccattggccaaaaaacttgcggaagacaagggtgtggatatc
gcattgatcaagggatctggtgaaggcggaaggatcatcaagcgtgatgtggagagcttt
gaccctgcttcggtacagcctgctgcccaatcgggtgtagcggcgccagcagccgtggga
caagagtcatacacggaagaaaaagtttcccaaatgcggaaaaccattgccaagcgattg
gcagaaagtaagttcagtgcgccgcacttctacctgaccatggagatcaacatggacaag
gcaatcgaagcgcgaaaaagcatgaatgaaattgctccagtgaagatctccttcaatgac
atggtgatcaaagcggtggccgcctcactgaagcagcatccaaaagtgaattccagctgg
ctgggagataaaatccgttataacgagcacgttcatatcggaatggccgtggccgtagaa
gagggacttttggtaccggtgattcgtttcgcggacagcaagacgttatcccagatttcc
caagaagccaaaacccttggtggaaaagccaaaaacaaagaactgcagcctaaagattgg
gaaggaaacacctttaccatttcaaacttggggatgtttggcattgaagaatttacggca
atcgtaaatccgccagatgcatgtatccttgctgtgggaggaatcaaggaaacggttatc
gtaaaagatggtcagatgcaggtaggaaacgtgatgaaagtaaccttgtcttgtgatcac
cgagtggtcgacggggcagtaggctctggtttccttaaaaccctcaagggactattggaa
gatcctgtgagaatcttgatttaa

DBGET integrated database retrieval system