KEGG   Echinicola vietnamensis: Echvi_4668Help
Entry
Echvi_4668        CDS       T02388                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K16216  benzil reductase ((S)-benzoin forming) [EC:1.1.1.320]
Organism
evi  Echinicola vietnamensis
Brite
KEGG Orthology (KO) [BR:evi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Echvi_4668
Enzymes [BR:evi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.320  benzil reductase [(S)-benzoin forming]
     Echvi_4668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR FOXO_KIX_bdg
Motif
Other DBs
NCBI-ProteinID: AGA80835
UniProt: L0G7K3
Position
complement(5586731..5587456)
Genome map
AA seq 241 aa AA seqDB search
MKNLFILTGCSKGLGKGLLDVLVADTNNMVVGISRSSMDSSVNFKHITLDLADVEALPQK
LGGIFPQGRFERVALINNAGWIGEIAPVGSLEPQSIASIYAINVVAPAILMNAFVQKYAD
QDIQKTVVNISSGAAAKNMDGWSGYCSTKAALNRMTGVAQEESDLKGYGIRYFALSPGIV
DTPMQETIRSAKPSDFSNVDKFKSFKANQELTTPAAVAEKVLYLLHHEGEFEGVLQDVRK
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctcttcattttaaccggatgtagcaaaggattgggcaaaggcctgttggat
gtccttgtggcagataccaataatatggtggtgggaatttcgcgttcatccatggattct
tctgttaattttaagcatattacgcttgacctggccgatgtggaggcattgccccagaag
cttggcgggatttttccgcagggacgttttgagcgggtcgctttgatcaataatgctggg
tggataggggaaatagcgcctgttggcagcttggaaccccaaagtatagcgagtatatac
gccatcaatgtcgtagcaccggccatattgatgaatgcatttgtccaaaaatatgccgat
caggacattcaaaagaccgtggtgaacatctcatccggggcggcagccaaaaacatggat
ggctggtcaggatattgcagtaccaaggcggccctaaaccgaatgacgggtgtggcgcag
gaggaaagtgatctgaaaggatacgggatccggtattttgcgctttcaccagggattgtg
gatacgcccatgcaggaaaccatccgttcggcaaagccatcagacttcagcaatgtggac
aagttcaagtcctttaaagccaaccaagaactgaccactcccgctgcggtggccgagaag
gtgctgtacctactgcatcatgaaggggagtttgagggagtgctgcaggatgtaaggaag
ttctag

DBGET integrated database retrieval system