KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_07270Help
Entry
BFV63_07270       CDS       T04821                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00260  Glycine, serine and threonine metabolism
exf01100  Metabolic pathways
exf01110  Biosynthesis of secondary metabolites
exf01120  Microbial metabolism in diverse environments
exf01130  Biosynthesis of antibiotics
exf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BFV63_07270
Enzymes [BR:exf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BFV63_07270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Rhomboid_N
Motif
Other DBs
NCBI-ProteinID: AOP90712
Position
complement(1539296..1540297)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAPDGTLPLDKVAAKI
KADDIHFARTKLLSLENTHNGKVLPREYLKAAWDFTRERKLGLHVDGARIFNAVVEYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGSADYIRRANRWRKMTGGGMRQAGILAAAGLY
ALKNNVSRLKDDHDNAAWMAAQLREIGAEVMRHDTNMLFVRVGDEHAAALGDFMKARGVL
INASPVVRLVMHLDVNREQLTEVVKHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgcccgagccgcgccatgctcgaagagatg
atggccgccccggtcggggacgacgtctacggcgatgacccgacggtcaacgaactccag
cgctatgcggccgagctgagcggtaaagaggctgctctgttcctgcccaccggcacgcag
gctaacctggtggcgctgctgagccactgcgagcgcggcgaagagtatatcgttggccag
ggggcgcataactacctgtacgaagccggcggcgcggcggtgctcggcagcatccagccg
cagccgatcgatgctgcgccggacggtacgctgccgctggacaaagtcgcggcgaaaatc
aaagctgacgatattcacttcgcccgcactaaactgctgagcctcgaaaacacccataac
ggtaaagtcctgccgcgtgaatacctgaaagcggcatgggattttacccgcgagcgcaag
ctcggcctccacgttgacggcgcacgtatcttcaacgccgtggtggagtacggctgcgag
ctgaaagagatcacccaatattgcgactcgttcaccatttgcctctctaaagggctgggc
acgccggtaggttccctgctggttggcagcgcagactacatcagacgcgccaaccggtgg
cgcaaaatgaccggcggcgggatgcgtcaggcgggtattctggcggctgccggactgtac
gccctgaaaaataacgtgtcacgcctgaaagacgatcacgataatgcggcgtggatggca
gcgcagctgcgtgaaatcggcgctgaagtcatgcgacacgacaccaacatgctgtttgtc
cgcgtcggcgatgagcatgctgccgcgctgggcgactttatgaaagcccgaggcgtgctg
atcaacgcctccccggtcgtgcgactggtgatgcatcttgacgttaaccgcgagcagttg
accgaggtggtgaaacactggcaggcgtttttacagcgttaa

DBGET integrated database retrieval system