KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_08970Help
Entry
BFV63_08970       CDS       T04821                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00450  Selenocompound metabolism
exf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BFV63_08970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:exf03016]
    BFV63_08970
Enzymes [BR:exf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BFV63_08970
Transfer RNA biogenesis [BR:exf03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BFV63_08970
 Prokaryotic Type
    BFV63_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AOP91026
Position
1871296..1872339
Genome map
AA seq 347 aa AA seqDB search
MSEQTIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINNLPPEIARD
VIEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKRNSTAQPGCKLFLTKPL
GIGVLTTAEKKSLLKPEHIGLATEVMCQMNLAGAAFANIDGVKAMTDVTGFGLLGHLSEV
CQGAGVQAQIWYQDVPKLPGVEEYIAQGAVPGGTQRNFASYGHLMGEMPEAWRNLLCDPQ
TSGGLLLAVTPEAEADVQATAAEFGITLTAIGELVTARGGRPMIEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaccattcgtttaacgcaatacagccacggagccggttgcggttgtaaa
atttccccgaaagtgctggagaccatcctgcacagtgagcaggcgaagtttgtcgacccg
aacctgcttgtcggtaacgaaacgcgtgacgatgcagcggtttatgacttaggtaacggc
accagcattatcagcaccactgacttttttatgccgattgtcgacaacccattcgacttc
ggacgcattgcggccaccaacgccatcagcgatatctttgcgatgggcggtaaaccgatc
atggcgatcgccattctgggctggccgattaacaacctcccgcctgagattgcccgcgac
gtgatcgaaggcggacgctttgcctgccagcaggcgggtattgccctggccggtggtcac
tctatcgatgcgccggagccgatcttcggcctggccgtcaccggcgtggtgcccaccgaa
cgcgtgaagcgcaacagcacggcgcaaccgggctgcaaactgttcctcaccaagccgctg
ggcattggcgtactgaccactgccgagaagaaatccctgctgaagcccgagcatataggt
ctggcaacggaagtgatgtgtcagatgaacctcgccggtgcggcattcgccaatatcgac
ggcgtgaaggccatgaccgacgtgaccggatttggtctgctggggcacctctctgaagtg
tgtcagggcgcgggcgtgcaggcgcagatctggtatcaggatgtgccgaaactgccgggc
gtggaagagtacattgctcagggcgcggtgccgggcgggacgcagcgcaacttcgccagc
tacggccatttaatgggcgaaatgccggaagcatggcgtaacctgctgtgcgatccgcaa
acctccggcggtctgctgctggcggtgacgccggaagctgaagctgacgttcaggcgacg
gctgccgagtttggcatcaccctgacggccattggcgagctggtgaccgcccgcggtggc
cgcccgatgattgagatccgttaa

DBGET integrated database retrieval system