KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_11275Help
Entry
BFV63_11275       CDS       T04821                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00052  Galactose metabolism
exf00500  Starch and sucrose metabolism
exf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BFV63_11275
   00500 Starch and sucrose metabolism
    BFV63_11275
Enzymes [BR:exf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BFV63_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AOP91455
Position
complement(2350840..2352246)
Genome map
AA seq 468 aa AA seqDB search
MTLTSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWRHDRLWYMVLGAQDRH
KRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFELDDTHVLICCPQGLAR
EPHRYLNTYPAVWMSGAFDYQTPAFTHGELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTRAHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHHWQGRASDAPVL
AGARLEFELSASCVNVDFAGALRLIVDDAGIRLERASLKTADTLTRYWQGTVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgactttaacttcccgctggcctgccgtattgcaggccgtgatgcaaggccagccgcgt
gcgcttgcggacagccactatccgcaatggcatcccgcgccggtgacggggctgatgaac
gatccgaacggctttatctggtttgccggacgctatcatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgctggggacactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaacggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgacggcacg
tttgccaaactgggaccggtgttgcctctgccggacgggtataccgggcacgtccgcgat
ccgaaagtgtggcgccatgacaggctgtggtacatggtgctcggggcgcaggatcggcat
aagcgcggcaaggtgctgctgtttacgtcagccgatttacacacctgggcgtcctgcggc
gaaatcgccggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgagcttgatgacacacacgtcttgatctgctgcccgcaggggctggcgcgc
gaaccgcatcgctatctcaacacctatccggccgtctggatgagcggggcatttgattat
caaacccctgcatttacgcacggcgagctgcatgagcttgacgccggattcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcatcggctggatgggcgtg
ccggacggcgaagagatgctccagcctacgcgggcgcacggctggatccaccagatgacc
tgtcctcgcgagctgcgctaccgcgacggtaagctctggcagaccccggtccgtgagctg
gaaacgctgcgcgaggatgaacaccactggcagggacgcgccagcgatgccccggtgctg
gcgggagcgcgtcttgagttcgaactgagcgcctcgtgcgtgaacgtggattttgccggc
gcgttgcgactgattgtggatgatgcggggatccgtctggaacgcgccagtctgaaaacc
gcagacacgctgacccgctactggcagggcactgttcatcatttacgcgtgctgtgtgac
cgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggtacgcttcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system