KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_14925Help
Entry
BFV63_14925       CDS       T04821                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00020  Citrate cycle (TCA cycle)
exf00620  Pyruvate metabolism
exf01100  Metabolic pathways
exf01110  Biosynthesis of secondary metabolites
exf01120  Microbial metabolism in diverse environments
exf01130  Biosynthesis of antibiotics
exf01200  Carbon metabolism
Module
exf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
exf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFV63_14925
   00620 Pyruvate metabolism
    BFV63_14925
Enzymes [BR:exf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BFV63_14925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AOP92121
Position
complement(3120895..3122544)
Genome map
AA seq 549 aa AA seqDB search
MKKMTAVLFSLAVGLNAVSLAAKAYAPKEQETDVLLIGGGIMSATLGTYLQELEPNWSMT
MVERLDGVAQESSNGWNNAGTGHSALMELNYTPQKKDGSISIEKAVEINEAFQISRQFWS
HQVNSGVLHNPHSFINTVPHMSFVWGDQNVNFLRARYAALQQSTLFRGMKYSEDHAQIKE
WAPLVMEGRDPNQKVAATRTEIGTDVNYGEITRQLVASLKKKENFNLQLSSEVRGFKRNA
DNSWSVTVADLKNNEAEHVIKAKFVFIGAGGAALKLLQESGIPEADDYAGFPVGGQFLVS
ENPEVVNRHLAKVYGQASVGAPPMSVPHIDTRMLDGKRVVLFGPFATFSTKFLKNGSLWD
LLSATTTSNVKPMMDVGLDNFDLVKYLISQVMLSDEERFEALKEYYPQAKKEDWRLWQAG
QRVQIIKRDPKEGGVLRLGTEVVSDKDGTIAALLGASPGASTAAPIMLHLMEKVFKDKVS
SPEWQAKLKTIIPSYGTKLNGNVEATEQELEYTSRVLQLQYVKPQAADAAPKAELKPQAE
SKPVADIAL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgactgccgtgctcttttctctggccgtggggctgaacgccgtctcgctg
gcggcgaaggcttacgcaccaaaagagcaggaaacggatgtccttttaattggtggcggc
atcatgagcgccacgctgggaacgtatcttcaggaattagagccgaactggtccatgacc
atggtcgagcgcctcgatggcgtggcacaggaaagctctaacggctggaacaacgccggg
acggggcactcggcactcatggaactgaactatacgccgcagaaaaaggacggttccatt
agtatcgagaaggcggtagagatcaacgaagcgttccagatctcacgtcagttctggtct
caccaggtgaacagcggtgtgttgcacaatccgcactccttcatcaacaccgtaccgcac
atgagctttgtgtggggcgatcaaaacgtcaacttcctgcgcgcgcgctacgctgccctg
caacagagcacgcttttccgcgggatgaaatactctgaagatcacgctcaaatcaaagag
tgggcgccgctggtcatggaaggccgcgatccgaaccagaaagtggcggcgacccgcact
gaaattggtactgacgttaactacggtgaaatcacccgtcagctggtggcctctctgaag
aaaaaagagaactttaacctgcaactcagctccgaagtgcgtggtttcaagcgcaatgcg
gataacagctggagcgtgaccgttgccgatctgaaaaacaacgaagccgagcatgtgatt
aaggcgaagttcgtgtttatcggtgcgggcggcgcggcgctgaaactgttgcaggagtcc
ggtattccggaagcggacgactacgcgggcttcccggttggcggccagttcctggtgtcg
gaaaacccggaagtggttaaccgtcatctggcgaaagtgtacggtcaggcctctgtgggc
gcaccaccgatgtccgttccgcatatcgacacccgcatgctggacggtaagcgtgtagtg
ctgttcgggccgttcgccacattctccaccaagttcctgaaaaacggttccctgtgggat
ctgttgagcgcgaccacaacgtcaaacgtcaagccaatgatggacgtggggctggataac
ttcgatctggtgaaatacctgattagccaggtgatgctctctgatgaagaacgcttcgag
gcgctgaaagagtactatccgcaggcgaagaaagaagactggcgtctgtggcaggcaggt
cagcgtgtgcagatcatcaaacgcgatccgaaagagggcggcgtgctgcgtctgggtacc
gaagtggtaagcgataaggatggcaccattgccgcgctgctgggggcatctccgggggcg
tctaccgctgcgccaatcatgctgcacctgatggaaaaagtgtttaaagacaaagtatcc
agcccggaatggcaggcgaagctgaaaaccattattccatcctacggtacgaagctgaac
ggtaacgttgaggccacggaacaagagctggaatacaccagccgcgttctgcaactgcaa
tacgtcaaaccgcaggctgcggatgctgcgccaaaggcagagctgaagcctcaggcggaa
agcaagccggtagcggatatcgcgctgtaa

DBGET integrated database retrieval system