KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_16005Help
Entry
BFV63_16005       CDS       T04821                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00230  Purine metabolism
exf00240  Pyrimidine metabolism
exf01100  Metabolic pathways
exf01110  Biosynthesis of secondary metabolites
exf01130  Biosynthesis of antibiotics
Module
exf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
exf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
exf_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
exf_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BFV63_16005
   00240 Pyrimidine metabolism
    BFV63_16005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:exf04131]
    BFV63_16005
Enzymes [BR:exf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BFV63_16005
Membrane trafficking [BR:exf04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BFV63_16005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AOP92324
UniProt: A0A422XFH7
Position
complement(3358237..3358668)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFESAGFKIVGTKMLHLTVEQARGFYAEHEGRPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPDNALAGTLRADYADSFTENGTHGSD
SVESAAREIAFFFAEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacgtactttttccatcatcaaaccaaacgcggtggcaaaaaacgttatt
ggcagcatcttcgctcgctttgaatcagcagggtttaagatcgttggcaccaaaatgctg
cacctgaccgttgaacaggctcgcggtttctacgctgagcacgaaggtcgcccattcttt
gacggtctggtcgagttcatgacttctggcccaatcgtggtatccgtactggaaggcgaa
aacgcggtacagcgtcaccgcgatctgctgggtgcaaccaacccggacaacgcactggca
ggtactctgcgcgccgactacgcagacagcttcaccgagaacggcacccacggttccgac
tctgttgaatctgctgcgcgcgaaatcgcgttcttcttcgctgaaggcgaagtgtgcccg
cgcactcgctaa

DBGET integrated database retrieval system