KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_20485Help
Entry
BFV63_20485       CDS       T04821                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:exf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BFV63_20485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:exf02022]
    BFV63_20485
Two-component system [BR:exf02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BFV63_20485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AOP93158
UniProt: A0A4V7S857
Position
complement(4267630..4268349)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaaaattctggtcgtagatgacgacatgcgcctgcgtgcgctgctg
gaacgttatctgaccgagcagggcttccaggttcgtagcgtcgcgaacgcggaacagatg
gatcgtctgctgacgcgtgaatctttccacctgatggtgttggacctgatgctgcctggc
gaagacgggctctctatttgccgccgtctgcgcagccagagcaacccgatgccgatcatc
atggtgacggcgaagggtgaagaagtcgaccgtattgtcggccttgagattggcgctgat
gactacattccaaagccgtttaacccgcgtgaactgctggcgcgtattcgcgccgtgctg
cgtcgtcaggcgaacgaactgccgggcgcgccatctcaggaagaggccgtcattgcattc
ggtaagtttaagctgaacctcggcacccgtgagatgttccgtgaagatgagccaatgccg
ctcaccagcggtgagttcgcggtgctgaaagcgctggtcagccacccgcgtgagccgctc
tcccgtgacaagctgatgaacctggcgcgtggtcgtgaatactccgcgatggagcgttct
atcgacgtgcaaatctctcgtctgcgtcgtatggtggaagaagatccggcgcatcctcgt
tatattcagaccgtttggggtctgggctacgtgtttgtcccggacggctctaaagcatga

DBGET integrated database retrieval system