KEGG   Enterobacter hormaechei subsp. xiangfangensis: BFV63_21310Help
Entry
BFV63_21310       CDS       T04821                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
exf  Enterobacter hormaechei subsp. xiangfangensis
Pathway
exf00051  Fructose and mannose metabolism
exf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BFV63_21310
Enzymes [BR:exf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BFV63_21310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOP93310
UniProt: A0A422XH77
Position
4455547..4456695
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARHSYQVHVVGENEQVETV
SGVNAVSSIGDDVIDLIASVDLVTTAVGPVVLERIAPAVAKGLAKRKAQGVETPLNIIAC
ENMVRGTTQLKGHVLAAVADEDKAWVEAHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DENIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHYRSEQDPQAIELAQLIDDKGAQAALAQ
ISGLDANSDVVAEAVSAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatattggtcgtggctttatcggtaaactgctg
gcagacgcgggcattaccctgacattcgccgatgtgaatcaggtggttctggatgccctg
aatgcccgtcatagctatcaggttcacgtggtgggtgaaaacgaacaggttgaaacggtc
tctggcgtcaacgcggtaagcagcattggcgacgatgttatcgatcttattgccagcgtt
gatctggtcaccacagccgtgggtccggtagtgcttgagcgtatcgccccggcggtcgcg
aaaggcctggcgaagcgtaaagcacagggcgttgaaacgccgctgaacatcatcgcctgt
gaaaacatggtgcgcggcaccacgcagctgaaaggccacgttcttgcggccgtcgccgac
gaagataaagcctgggttgaagcgcacgtaggttttgttgattccgccgtggatcgcatc
gttccgccgtcagcatccgccaccaacgacccgctggaagtgaccgtggaaaccttcagc
gagtggatcgttgataaaacccagtttaagggcgcgctgccgaccattccgggaatggaa
ttaaccgataacctgatggcatttgtcgaacgtaaactcttcacgctgaacaccgggcat
gctataaccgcgtacctcggaaaattggccggtcatcagaccattcgtgacgcgatcctc
gatgagaacatccgtgcggtggtcaaaggggcaatggaagagagcggcgcggtgctgatc
aaacgctacggttttgatgctgataaacacgcagcatacatccagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgacgttgagcgcgtgggtcgtcagccgctgcgtaaa
ctgagcgcgggcgatcgcctgattaaaccgctgctgggcacgctggaatacggcctgccg
cacgctaacctggtgaagggaatcgctgccgcaatgcactaccgcagcgagcaggacccg
caggcaattgagctggctcagctgattgatgacaaaggcgcgcaggctgcgctggcgcag
atctccggtctggatgccaacagtgacgtagttgcggaggcggtcagcgcatacaacgca
accaaatga

DBGET integrated database retrieval system