KEGG   Exiguobacterium sp. MH3: U719_01070Help
Entry
U719_01070        CDS       T02903                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
exm  Exiguobacterium sp. MH3
Pathway
exm00030  Pentose phosphate pathway
exm01100  Metabolic pathways
exm01120  Microbial metabolism in diverse environments
exm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:exm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U719_01070
Enzymes [BR:exm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     U719_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase F420_oxidored NmrA Polysacc_synt_2 GDP_Man_Dehyd H-kinase_dim
Motif
Other DBs
NCBI-GeneID: 17604549
NCBI-ProteinID: AHA28545
Position
complement(185283..186068)
Genome map
AA seq 261 aa AA seqDB search
MYESLKGKVAIVTGGSMGIGEAIVRRYAEEGMRVVINYRSHPEEAKKIAESIQDKGGEAI
TIQGDVSKEDDMINLVKETVAHFGQLDVFVNNAGIEMPSASHEMSLEDWQKVIDVNLTGA
FLGAREALKYFVEHDVKGSIINMSSVHEIIPWPTFVHYAASKGGVKLMTQTLAMEYAPKG
IRVNAIGPGAINTPINAEKFEDPEQRKEVESMIPMGNIGKPEEISAVAAWLASDEASYVT
GITLFADGGMTLYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaagtttaaagggaaaagtagccatcgtaacaggtggatcaatgggaatcggt
gaagccatcgttcgccgttatgcagaggaaggtatgcgtgtcgtcatcaactatcgcagt
catccggaagaagcgaagaaaatcgctgaatcgattcaagataaaggcggcgaagctatt
acgattcaaggagatgtctcgaaagaagacgatatgatcaaccttgtcaaagagactgtc
gctcactttggtcagttggatgttttcgtcaacaacgcagggattgaaatgccttcagcc
tcccatgagatgtcactcgaagactggcaaaaagtcatcgacgtcaacttaacaggtgca
ttcctcggtgcgcgtgaagctctgaagtacttcgtcgaacacgatgtcaaaggtagcatc
atcaacatgtcgagtgttcatgaaatcattccatggccaacgttcgtccactacgctgca
agtaaaggtggcgtcaaattgatgacacaaacccttgcgatggaatatgcaccaaaaggc
attcgggtcaatgcgattggacctggtgcgattaatacaccgatcaatgctgaaaaattc
gaagatccggaacaacgaaaagaagtcgagagtatgattccaatgggcaatatcggaaaa
cctgaggaaatttcagccgttgccgcatggcttgcgtcggacgaagcgagttatgtcact
ggtatcacactctttgcggacggcggaatgacactttatccatcgttccaagcaggacgc
ggttaa

DBGET integrated database retrieval system