KEGG   Exiguobacterium sp. MH3: U719_03725Help
Entry
U719_03725        CDS       T02903                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
exm  Exiguobacterium sp. MH3
Pathway
exm00860  Porphyrin and chlorophyll metabolism
exm01100  Metabolic pathways
exm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:exm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    U719_03725
Enzymes [BR:exm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     U719_03725
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     U719_03725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 MCRA NAD_binding_9 HI0933_like Trp_halogenase Pyr_redox_2 FAD_oxidored FAD_binding_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 17605077
NCBI-ProteinID: AHA29010
Position
714290..715699
Genome map
AA seq 469 aa AA seqDB search
MSSKRLVIVGGGISGLAAAYYAEKQFPEMNITLLEAEGRLGGKVATYRDEGLTIERGPDS
YVARKHVLTDLIEEIGLGEQLVRNNTSQAYILDARGLHPIPKGAVMGIPTDLELFAETSL
LTEEEKAEVTERLLHPAPDLTIPETDIPLGEYLRPRLGDALVEKLIEPLLSGIYAGDIDR
MSTFATYPQFVANEQKAGSLFEGMRLMRPLDQQQGPTLKATGQFLSLATGLESLVERLEE
VLERTEIRLETPLRSIEREEGGRYRLETDHGPEYADDILLTIPHRQVVSLLPDATLPGLA
NLSTHSTATVTLIFDKETALPIDGTGFIVNRRAPYSITACTAIDQKWNHAAPNHTVLRAF
IGRPGKDALVRESDEMIERVVLEDLENICGRPLQPERVVISRLLDGLPAYTVGHAQRIQE
VREIVASHYPHIHLAGLAYDGVGLPDCVAGVKATLEQMALQQPEPCKES
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtaaacgtctcgtcatcgtgggcggtggtatatcaggacttgcagccgcctat
tatgcagagaagcagtttccagagatgaacatcacgttactcgaggcagagggtcgtctc
ggtggtaaggtggcgacatatcgggacgaaggattgacgatcgagcggggaccggattca
tacgtcgcacggaaacacgtgttgacggatctcatcgaagagatcggattaggggagcaa
ctcgttcgcaataacacgtcgcaagcgtatatcttggatgcgcgcggtctccacccgatt
ccaaaaggtgccgtcatgggcatcccgaccgatttagagttattcgcagagacgtctcta
ctgacggaagaagaaaaggcagaggtgacagaacgcttgcttcaccctgctcctgatttg
acgattccggaaacagacatcccattaggggaatacctgcgtccgcgtcttggagatgcg
ctcgtcgagaagctgatcgaaccgcttctttcaggcatctatgcgggtgatatcgaccgg
atgagtacgttcgcgacctacccgcaattcgttgcgaatgagcaaaaggctggaagcttg
ttcgaagggatgcgcctcatgcgtccgcttgatcaacaacaaggtccgacgctcaaagcg
acaggtcaattcctatcacttgctactggactcgagtctctcgtcgagcgtttagaagag
gtgctcgaacggacagagattcgtctagagacaccacttcgctccatcgaacgggaagaa
ggcgggcggtatcgtctcgaaacggatcatggtccagaatatgctgatgatattttgttg
acgattccgcatcgccaagtcgtgtccctgttaccagatgcgacgcttccagggcttgcg
aacctttcaacacactcgacggcgacggtcacgttgattttcgataaggaaacagcgtta
ccgattgatggaacgggattcatcgtcaaccgtcgggcgccgtattcaattacagcatgc
acggcgattgatcaaaagtggaatcatgcagcaccgaatcataccgtgctccgtgccttc
atcggacgccccggaaaagatgcactcgttcgtgaatctgacgaaatgattgaacgcgtc
gtcttagaagatcttgaaaacatctgtggtcgtccattgcaaccggaacgtgtcgtcatc
agtcgtctcttagacggcttaccggcctatacggtaggacatgcacagcggattcaagaa
gtgcgagaaatcgtcgcttctcattatccgcacattcatttagccggactcgcctatgat
ggtgttggattgccagactgtgtagcaggtgtcaaagcgacgcttgaacaaatggcgtta
caacaaccggaaccatgtaaagaatcatga

DBGET integrated database retrieval system