KEGG   Exiguobacterium sp. MH3: U719_06010Help
Entry
U719_06010        CDS       T02903                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
exm  Exiguobacterium sp. MH3
Pathway
exm00071  Fatty acid degradation
exm00072  Synthesis and degradation of ketone bodies
exm00280  Valine, leucine and isoleucine degradation
exm00310  Lysine degradation
exm00362  Benzoate degradation
exm00380  Tryptophan metabolism
exm00620  Pyruvate metabolism
exm00630  Glyoxylate and dicarboxylate metabolism
exm00640  Propanoate metabolism
exm00650  Butanoate metabolism
exm00900  Terpenoid backbone biosynthesis
exm01100  Metabolic pathways
exm01110  Biosynthesis of secondary metabolites
exm01120  Microbial metabolism in diverse environments
exm01130  Biosynthesis of antibiotics
exm01200  Carbon metabolism
exm01212  Fatty acid metabolism
exm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:exm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U719_06010
   00630 Glyoxylate and dicarboxylate metabolism
    U719_06010
   00640 Propanoate metabolism
    U719_06010
   00650 Butanoate metabolism
    U719_06010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U719_06010
   00072 Synthesis and degradation of ketone bodies
    U719_06010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U719_06010
   00310 Lysine degradation
    U719_06010
   00380 Tryptophan metabolism
    U719_06010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U719_06010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U719_06010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U719_06010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:exm04147]
    U719_06010
Enzymes [BR:exm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U719_06010
Exosome [BR:exm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U719_06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 17605533
NCBI-ProteinID: AHA29431
Position
1172340..1173530
Genome map
AA seq 396 aa AA seqDB search
MSEAVVIVSATRTAIGNFNGSLKDVKATELGATVIRAALEKAGVAGDHVDEVFFGNVLSA
GLGQNPARQAALAAGLPETCPAMTVNKVCGSGLSAVHLAYQAIKSGEADVIVAGGMENMS
QAPYVLSGARSGLKMGDQPLVDTIIQDGLECAFNDYHMGITAENLADAYELSREAQDQFA
ATSQQKAQTALAEERFVSEITPVLIPQRKGDPIRFDQDEFPRAGTSVETLSRLRPAFKKD
GTVTAGNASGINDGAAALVIMSASKAQELGVTPLVEIVANGTSGVDPSIMGIGPVQAVQK
ALDKAGLTLEEIDVIEANEAFAAQSLAVDAELQFPHEKLNRNGGAIALGHPIGASGARIL
VTLIHELERTGETHGLATLCVGGGQGVATIVKKYED
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcagtcgtcatcgtcagtgcgacgcgcacggcgatcgggaatttcaatggg
agtttgaaggacgtcaaagcaacggaactcggagcgacagtcatccgcgcagcacttgaa
aaagctggtgtcgcaggagatcacgtcgacgaagtctttttcggtaacgtcctctcagca
ggacttggtcaaaatccagcacggcaggcggcactcgctgccggattaccggagacatgt
ccagcgatgaccgttaacaaggtctgcggatccggtctctcagccgtccatctcgcgtat
caggcgatcaagtcgggcgaagccgatgtcatcgttgccggtgggatggagaacatgagc
caagcgccgtatgtcctatcgggcgcacggtctgggctgaagatgggtgaccaaccgctc
gtcgatacgatcatccaggatggacttgagtgtgcgtttaatgactatcacatgggaatc
acggcggagaatttagccgacgcctatgaactctcccgcgaagcccaggaccagttcgcg
gcgacgagtcagcaaaaagcgcagacggcattagcggaagaacggttcgtctcggaaatc
acaccagtgttgattccacaacgaaaaggcgacccgatccgttttgatcaagatgagttt
ccgcgtgccggaacatctgtcgaaacactcagtcgtttgcgcccagcattcaaaaaggac
ggaacggtcacggcaggcaatgcatccggcatcaatgacggggctgccgcacttgtcatc
atgtccgcgtcaaaggcacaagaactcggcgtgacaccactcgttgagatcgtcgcgaac
ggaacgtctggcgtcgacccgagcatcatgggaatcggtcccgtccaagcggtccaaaag
gcactcgataaagcgggactgacgcttgaggagatcgatgtcatcgaagcgaacgaagcg
ttcgcggcacaatctctcgcggtcgatgcggagctacagttcccgcatgagaagctcaac
cgaaacggcggtgcaatcgcgctcggtcatccgatcggtgcgagtggggcgcggattctc
gtaacgttgatccatgaactcgagcggacaggtgagacgcatggtcttgcgacgttatgc
gtcgggggcggtcaaggggtagcgacgatcgtcaaaaaatacgaagactaa

DBGET integrated database retrieval system