KEGG   Exiguobacterium sp. MH3: U719_16450Help
Entry
U719_16450        CDS       T02903                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
exm  Exiguobacterium sp. MH3
Pathway
exm00230  Purine metabolism
exm00250  Alanine, aspartate and glutamate metabolism
exm01100  Metabolic pathways
Module
exm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:exm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    U719_16450
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U719_16450
Enzymes [BR:exm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     U719_16450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 17607616
NCBI-ProteinID: AHA31158
Position
complement(3111545..3112837)
Genome map
AA seq 430 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSKQADVVARYQGGDNAGHTIVFNNETYKLHLIPSGIF
YSDKKCVIGNGLVVNPKSLVKELKYLHDRGVSTDNLLISNRAHVILPYHQLQDQLEEEAK
GDAKVGTTLKGIGPCYMDKAARIGIRMADLLDKETFAEKLKIVLDQKNRMFTKMYDAEPI
AFDDIFEEYYAYGQEFAKYVCDTSVVVNDSLDHGEKVLFEGAQGVLLDLDHGTYPFVTSS
NASAGGVASGVGVGPARIDHVVGVCKAYTSRVGDGPFPTELFDDIGHQIREVGREYGTTT
GRPRRVGWFDSVVVRHSRRTSGLTDLALNSIDVLTGLDTLKICTSYEFNGKQIDEYPASF
RDLEACVPVYEELPGWKEDITGVRRFEDLPLNAQNYVKRIADLTGISLVTFSVGPGREQT
VVLRDLYEEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagtagtagtagtcggaacacagtggggcgacgaaggaaaagggaaaatcacc
gattttctttcgaaacaagccgacgtcgtagcacgttatcaaggtggagacaatgcagga
catacgatcgtattcaataacgagacgtacaaattgcacttgatcccatcaggtattttt
tactcggataagaaatgtgtcatcgggaacggtctcgtcgtcaacccgaaatcactcgtc
aaggaattgaagtatctgcacgatcgtggtgtctcaacggataacttgttaatttcgaat
cgggcgcatgtcatcttgccgtatcatcagttgcaggatcagttagaagaagaagcgaag
ggcgacgcaaaagtcggaacgacgctaaaaggaatcggaccgtgctacatggataaagcc
gcacgaatcggaatccggatggcagacttactcgacaaagaaacgttcgctgagaagttg
aagatcgttctcgaccaaaagaaccggatgttcacgaagatgtatgacgctgaaccaatc
gcgttcgacgatatcttcgaagagtactatgcctatggacaagagttcgcgaaatacgtc
tgcgatacatccgtcgtcgtcaacgatagcctcgatcatggcgaaaaagtgttgttcgaa
ggcgcacaaggtgtcttactcgaccttgaccacggaacgtacccgttcgttacatcgtcg
aacgcatcagctggtggtgtcgcatcgggtgtcggtgttggtccagctcggatcgatcac
gtcgttggtgtctgtaaagcgtacacgtcacgagtcggtgatggtccgttcccaacggaa
ttgttcgatgacatcggtcaccaaatccgtgaagtcggtcgtgaatacgggacgacgaca
ggacgtccgcgtcgtgttggttggttcgactctgtcgtcgttcgccactcgcgccgtaca
agtgggttgacggatcttgcgctcaactcgatcgacgttttgacaggactcgacacgttg
aagatttgtacatcgtacgaattcaacggtaaacagattgatgagtacccagcaagcttc
cgtgatcttgaagcatgtgttccagtttacgaagaacttccaggctggaaagaggacatc
acaggtgtccgtcgctttgaagatctaccgttgaacgcacagaactacgtcaagcggatt
gcggatctcacaggtatctcgctcgtcacgttctcggtcggaccgggtcgtgaacagaca
gtcgtcttgcgtgatctctacgaagaagcataa

DBGET integrated database retrieval system