KEGG   Exiguobacterium sp. U13-1: ESP131_00460Help
Entry
ESP131_00460      CDS       T04561                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00740  Riboflavin metabolism
exu00790  Folate biosynthesis
exu01100  Metabolic pathways
exu01110  Biosynthesis of secondary metabolites
Module
exu_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ESP131_00460
   00790 Folate biosynthesis
    ESP131_00460
Enzymes [BR:exu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ESP131_00460
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     ESP131_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AOS98861
Position
complement(95107..96297)
Genome map
AA seq 396 aa AA seqDB search
MNGFDLIEDAIEDLKNGRPIIVCDDEDRENEGDLVMLAEHATPENINFMITHGKGLVCVP
VSPRIAQRLELAPMTANNTDPHGTAFTLSIDHEDAKTGISAEERSLTIQRMLIDGPERFK
RPGHIFPLIAKEGGVRERRGHTEAGVDLARLAGSDEIAVICEIIKEDGTMARVDDLLLYK
EEHGLKLITIEALVAYFERPLTREAEVLLPTTFGAFRMIGYTTQDDKEHVAVLSGEAYDG
MLVRLHSECLTGDVFGSKRCDCGPQLDAALERIEREGGAVLYLRQEGRGIGLMAKLKAYE
LQEQGLDTVEANHALGYPTDMRDYTVAANMLRDLGVTKIRLMTNNPDKQRVLEQEGIEVI
ERVPHQVPAEPENQRYLKTKQTKLGHWLDIQGGHTS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatggattcgacttgattgaagacgcaatagaagatttgaagaacggacgaccgatc
atcgtctgtgatgatgaggaccgtgagaatgagggcgatctcgtcatgctcgcggaacac
gcgacaccagaaaacatcaacttcatgatcacgcatggaaaaggactcgtctgcgtacca
gtcagtccgcggattgcacaacgactcgaacttgctccgatgacagcgaataatacggac
ccacatgggacggcattcacactcagtatcgatcatgaagacgcgaaaaccggtatcagc
gctgaagaacggtcgctaacgatccagcggatgctaatcgatggaccggaacggtttaaa
cgaccaggtcatatcttcccgttgatcgcaaaagaaggcggtgtccgggaacgacgcgga
catacggaagcgggcgttgatcttgcccgtcttgccggcagcgatgagatcgccgtcatc
tgtgaaatcatcaaggaagacggcacgatggcacgtgtggatgatctacttctctataag
gaagaacacggtttaaaactgattacgatcgaagcactcgtcgcgtacttcgagcgtcca
ttgacgcgggaagcggaagtgttacttccgacgacgttcggagctttccggatgatcggc
tatacgacgcaagacgataaagaacacgtcgctgtcttgtcgggtgaagcgtacgacggc
atgctcgtccggctgcactcggaatgcctgacgggggacgtcttcggttcgaagcgttgc
gattgtggaccgcaactcgatgcggcactcgaacggatcgaacgagaaggtggagccgtc
ttgtatttacgccaggaaggacgcggcatcggtctgatggcgaagttaaaagcgtacgag
ttacaagaacaaggacttgatacagtcgaagcgaaccatgcactcggttatccgacggat
atgcgtgactatacggtcgcggccaacatgttgcgcgatctaggcgtgacgaagatccgc
ttgatgacgaataatccggataaacaacgggtgctcgaacaagaagggatcgaagtcatc
gaacgtgtaccccatcaagtaccggctgaaccagaaaatcagcgctatctgaaaacaaaa
caaacgaaactcgggcactggctcgacatccaaggaggacacacatcatga

DBGET integrated database retrieval system