KEGG   Exiguobacterium sp. U13-1: ESP131_03125Help
Entry
ESP131_03125      CDS       T04561                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00220  Arginine biosynthesis
exu00330  Arginine and proline metabolism
exu01100  Metabolic pathways
exu01110  Biosynthesis of secondary metabolites
exu01130  Biosynthesis of antibiotics
exu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ESP131_03125
   00330 Arginine and proline metabolism
    ESP131_03125
Enzymes [BR:exu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ESP131_03125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AOS99306
Position
579878..580786
Genome map
AA seq 302 aa AA seqDB search
MNIAYISVPYRYGQGKPGTEHGPAAVEKAGLLATLEARGQEAVRYGEAAVLSEDAVREED
PKLKRLEGVVHTTNDLHLIVRDALSEQRFPLLVGGDHSMAIGTIAGLRQTVPRLGVIWFD
AHGDLNTPETSPSGNIHGMPLAVALGEGHQRLTEVGGTDVKLQPEHLVFIGLRDVDPGEQ
ELIDRLGIRVYDMEAIRTRGMDAIMEEAIAYLKETTDAFYLSFDMDGLDPSLVVGTGTRV
ADGIFLDDAKTVLKHCATAEDFIAAEFVEVNPLLEEGNGTAELANELIGDLLLAMETHRL
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgcgtatatcagcgtaccgtaccgttatggacaaggaaagccgggcactgaa
cacggacctgctgctgtcgaaaaagcgggtctactcgcgacactcgaagcacggggacaa
gaagcagtacgctacggggaagcggctgttttatccgaggatgcagtccgagaagaagat
ccgaagctgaaacgtcttgaaggcgtcgtccacacgacgaatgacttgcatctaattgta
cgtgatgcgttatcggagcaacgttttccgttattagtcggtggcgatcacagcatggcg
atcggaacgattgcagggttacgtcagactgtaccacgtcttggcgtcatctggttcgat
gcacacggtgatttgaatacaccggaaacatcaccgtctggtaacatccacggtatgccg
ctcgctgtagcccttggggaaggacatcagcgtttaacggaagtcggaggaacagatgtc
aagctgcaaccggaacatctcgtcttcatcggattacgtgacgttgatccaggcgaacaa
gagctgattgatcgtcttggtattcgtgtctatgatatggaagcgatccgaactcgggga
atggacgcgatcatggaagaagcgattgcttatttgaaggaaacgacggatgcgttctat
cttagcttcgatatggacggtctcgatccatcactcgtcgtcggtacaggaacacgtgtc
gctgacggtattttcttagacgatgcgaagacagtgctcaagcattgcgcaacggcagaa
gacttcattgcagctgaattcgttgaagtgaatccgttacttgaagaaggaaacggaaca
gcagaacttgcgaatgaactaatcggagatctacttttggcaatggaaacacatcgctta
gtaaaataa

DBGET integrated database retrieval system