KEGG   Exiguobacterium sp. U13-1: ESP131_08400Help
Entry
ESP131_08400      CDS       T04561                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
exu00071  Fatty acid degradation
exu00072  Synthesis and degradation of ketone bodies
exu00280  Valine, leucine and isoleucine degradation
exu00310  Lysine degradation
exu00362  Benzoate degradation
exu00380  Tryptophan metabolism
exu00620  Pyruvate metabolism
exu00630  Glyoxylate and dicarboxylate metabolism
exu00640  Propanoate metabolism
exu00650  Butanoate metabolism
exu00900  Terpenoid backbone biosynthesis
exu01100  Metabolic pathways
exu01110  Biosynthesis of secondary metabolites
exu01120  Microbial metabolism in diverse environments
exu01130  Biosynthesis of antibiotics
exu01200  Carbon metabolism
exu01212  Fatty acid metabolism
exu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:exu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ESP131_08400
   00630 Glyoxylate and dicarboxylate metabolism
    ESP131_08400
   00640 Propanoate metabolism
    ESP131_08400
   00650 Butanoate metabolism
    ESP131_08400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ESP131_08400
   00072 Synthesis and degradation of ketone bodies
    ESP131_08400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ESP131_08400
   00310 Lysine degradation
    ESP131_08400
   00380 Tryptophan metabolism
    ESP131_08400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ESP131_08400
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ESP131_08400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ESP131_08400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:exu04147]
    ESP131_08400
Enzymes [BR:exu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ESP131_08400
Exosome [BR:exu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ESP131_08400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOT00280
Position
1658125..1659315
Genome map
AA seq 396 aa AA seqDB search
MSEAVVIVSATRTAIGNFNGSLKDVKATELGATVIRAALEKAGVAGSHVDEVFFGNVLSA
GLGQNPARQAALAAGLPETCPAMTVNKVCGSGLSAVHLAYQAIKSGEADVIVAGGMENMS
QAPYVLAGARSGLKMGDQPLVDTIIQDGLECAFNDYHMGITAENLADVYELSREAQDQFA
ATSQQKAQTALAEERFVSEITPVLIPQRKGDPIRFDQDEFPRAGTSVEKLSRLRPAFKKD
GTVTAGNASGINDGAAALVIMSEAKAKELGVTPLVEIVANGTSGVDPSIMGIGPVQAVQK
ALGKARLSLDDIDVIEANEAFAAQSLAVDAELQFPHEKLNRNGGAIALGHPIGASGARIL
VTLIHELERTGETHGLATLCVGGGQGVATIVRSVRG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcagtcgtcatcgtcagtgcgacgcgcacggcaatcgggaatttcaatgga
agtttgaaggacgtcaaagcaacggaactcggagcgacggtcatccgcgcggcactcgag
aaagctggtgtcgcaggaagtcacgtcgatgaagtctttttcggcaacgtcctctcagca
ggacttggtcaaaatccagcacggcaggcggcacttgctgccgggttaccggagacgtgt
ccggcgatgaccgtcaacaaagtctgcggatccggtctatctgccgtccatctcgcgtat
caagcgatcaagtcaggcgaagctgacgtcatcgttgccggtgggatggagaacatgagc
caagcaccttacgtcctcgcgggtgcgcgctctggactgaagatgggagaccaaccgctc
gtcgatacgatcatccaggacgggctcgaatgtgcctttaacgactaccatatgggtatt
acggcagagaatttagccgatgtgtatgaactatcgcgcgaagcgcaggatcagttcgca
gcgacgagtcagcaaaaagcgcagacggcattagcggaagaacggttcgtctcagaaatt
acaccggttctgattccacaacgaaaaggcgatccgattcgttttgatcaagatgagttt
ccacgcgccggaacgtctgtcgaaaaactcagtcgcttgcgcccggcgttcaagaaggac
ggaacggtcacagcaggtaatgcgtcaggcattaacgacggtgctgccgcactcgtcatc
atgtcagaggcgaaggcaaaagaactcggcgtgacaccactcgttgagattgttgcgaat
ggaacgtccggtgttgatccgagcatcatgggaatcggtccagttcaagcggttcagaag
gcactcggtaaagcgagactctcgcttgacgatatcgatgtcattgaagcgaatgaagcg
ttcgcagcgcaatccctcgcggtcgatgcagagcttcagttcccgcatgaaaaacttaac
cggaacgggggagcaatcgctctcggtcatccaatcggtgcaagtggtgcgcgaattctc
gtcacgttgattcatgagctcgaacggacgggtgaaacgcatggtcttgcgacgttatgt
gtcggtggcgggcaaggggttgcgacgatcgtaaggtctgtaagaggatga

DBGET integrated database retrieval system