KEGG   Eggerthella sp. YY7918: EGYY_05870Help
Entry
EGYY_05870        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy00620  Pyruvate metabolism
eyy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EGYY_05870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eyy02000]
    EGYY_05870
Enzymes [BR:eyy01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EGYY_05870
Transporters [BR:eyy02000]
 Other transporters
  Primary active transporters [TC:3]
   EGYY_05870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: BAK43800
UniProt: F7UZ57
Position
645390..647282
Genome map
AA seq 630 aa AA seqDB search
MPRLQIMDTTIRDGQQSLWATRMQIGDMLPILPKMDRVGYWAIEAWGGATFDTCLRFLDE
NPWERLRSIKANTPNTPLAMLSRGQNLVGYKHYSHEICNRFIKAAKRNGIHVFRVFDALN
DIRNIVDNAEAIKECGGHFEGAISYTMSPVHTLDSYLDYGQQLKDLGADSIAIKDMAGML
TPYRTERMVKAFNAEIGLPLHIHCHYVGGMAPANIIKAAEAGAAIADTASAPLAFGNSHP
AVEMIVAALQESRYDTGLDLDLLFEIAEYWEEVRKRGHYKRGVSSLIHMQVYSHQVPGGM
MSNLISQLEVQNAVDRLPEVMKEIPKVRAEVGYPPLVTPMSQIVGTQAVFNVLTGKRWGV
VSKEMKDYICGYYGKAPGRMDKDIVAKVVGTSEMLPPDVAPGSLVTTTYSQVEDEIGDLA
KSEEDVLMYALFPNEARTFLSKHRTSEKVDFLMEEESSHTKEDDYVDINQIRELVRVAEE
SGVGEIVVEEEGTRIAVRMPGTVSGEVAAPVAAPPVAAVAAAPAATAAAAPAPAESEHPS
NWYAVTAPMVGTFYSSPAPGEPPFVQVGDEVAANQTLCIVEAMKLMNEITAEEMGTVREV
CLEDATPVEFGTVLFYIEPHGAPAPAPETA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggctccagatcatggataccaccatccgtgacggccagcaaagcctttgggct
acgcgcatgcaaattggcgatatgctgccaatcctgccgaaaatggaccgcgttggatac
tgggctatcgaggcctggggtggtgccacgtttgacacctgcctgcgctttcttgatgag
aacccgtgggagcgactgcgctccatcaaggcgaacacgccgaatacaccgcttgctatg
ctgtcccgcggtcagaacctcgtgggctacaagcactactcgcacgagatttgcaatcgt
ttcatcaaggcggccaagcgtaacggcattcacgtgttccgcgtgttcgacgcgctgaac
gacatccgcaacattgtggacaacgccgaagccatcaaagaatgcggcggacacttcgaa
ggcgccatttcctacaccatgtcgccggtgcacacacttgacagctacctggactatggc
cagcagctcaaggatctgggcgccgactccatcgccatcaaagacatggctggcatgctc
acgccgtatcgcaccgagcgcatggtcaaggccttcaacgccgagatcggcctgccgctg
cacatccactgccactacgtgggcggcatggctcctgccaacatcatcaaggccgccgaa
gcgggtgccgctattgcggacacggcttctgcgccgcttgcgttcggtaactcgcatccg
gctgttgaaatgattgtcgcggcgcttcaggaaagccgctacgatacgggcctcgacctt
gatctgctgttcgagattgccgagtactgggaagaggtgcgcaagcgcggccactacaag
cgcggcgtgtcgtccctcatccacatgcaggtgtactcgcatcaggtgcccggcggtatg
atgtcgaacctcatttcgcagctcgaggtgcaaaatgcggtcgatcgtctgcccgaggtt
atgaaggaaatcccgaaagtacgcgccgaagtgggctatccgccgcttgtaacgcccatg
tcgcaaatcgtgggcacccaggcggtgttcaacgtgctgaccggcaaacgctggggcgtc
gtgtccaaagagatgaaggactacatttgcggttactacggcaaggcgccgggccgcatg
gacaaggatattgttgcaaaggtggtgggcacttccgagatgctgccgcctgacgtggcg
ccaggttcgctggttacaacaacctactcccaggtggaggatgaaattggcgatctcgca
aagagcgaagaggacgtgcttatgtatgcgctcttccccaatgaggcgcgcacgttcctg
agcaagcatcgcacatcggagaaggtcgacttcctcatggaggaagaatcgagccatacc
aaggaggacgattacgtggacatcaatcagattcgcgagctggttcgcgttgccgaagag
agcggcgtcggcgagattgtggttgaggaagaaggaacgcgcattgcggtgcgcatgccg
ggcaccgtatcgggagaagttgccgctcccgttgcagccccgccggttgccgcagtagcg
gcggcccctgcggcgacggctgctgctgctcccgctcccgccgagtctgagcatccgtcg
aattggtatgccgtcacggcgccgatggtgggtacgttctactcgtcgcccgctcccgga
gaaccgccgtttgtgcaggtgggtgatgaggttgcggcaaaccagacgctctgcatcgtg
gaagccatgaagctcatgaacgagatcacggccgaggaaatgggtaccgtgcgcgaggtg
tgccttgaggatgcgactcctgtcgagttcggcaccgtgctgttctatatcgaaccgcat
ggcgcaccggcaccggctccggagacggcgtaa

DBGET integrated database retrieval system