KEGG   Eggerthella sp. YY7918: EGYY_19080Help
Entry
EGYY_19080        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
eyy  Eggerthella sp. YY7918
Pathway
eyy00471  D-Glutamine and D-glutamate metabolism
eyy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eyy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EGYY_19080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eyy01011]
    EGYY_19080
Enzymes [BR:eyy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     EGYY_19080
Peptidoglycan biosynthesis and degradation proteins [BR:eyy01011]
 Precursor biosynthesis
  Racemase
   EGYY_19080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: BAK45035
UniProt: F7UV12
Position
complement(2075498..2076394)
Genome map
AA seq 298 aa AA seqDB search
MDQDSTQLEDMPCVFDNAPIGVFDSGFGGLTVAREIAKALPHESIVYVGDSARCPYGPRS
LDEVGGYVQQIGSWLVDHGVKLIVIACNTATAAGLAEAQRTFPVPVIGVVEPGARAAAHA
TKNRRVGVIATKATVESDAYTKAIRHIDAGITVFSTATPRFVEIAEQGIRMAEGPIENYT
SLASKVYIRPAFQEIAREYLEPLRRCDIDTLVLGCTHFPLLKALIGGVVGREVTLISSAK
EAARDVAEALGRRNALAGIDREPRYDFFTTGEDIDEFRSFGSRVFRTPIDNVAHVDLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggatagtacacagcttgaagatatgccttgcgtcttcgataacgcgcctatc
ggcgtgttcgattcgggcttcggcggtcttaccgttgcgcgcgagatagcgaaggcgctt
ccccatgaatccatcgtctacgtgggcgattccgctcgctgcccctatggtccccgttcc
cttgacgaagttgggggttatgttcagcagataggaagctggctggttgatcatggcgtg
aagctgattgtcatcgcatgcaatacagctacggccgcgggtcttgccgaggcgcagcgc
acgtttccggtgccagttatcggcgtggtggagccaggtgcgcgagccgccgctcacgcc
accaaaaaccgacgtgtgggagttattgccaccaaagcgacggtggaatcggatgcgtat
acgaaggccatcaggcatatcgatgctggtattacggtgttctctacggcaacgccgcgc
tttgttgaaatcgccgaacagggcattcgtatggccgaggggcctatagaaaactacacc
tcgcttgcgtccaaggtttacattcgccctgcctttcaggaaatcgctcgggaatatttg
gagccgctcaggcgctgcgatatcgatacgctcgtgcttgggtgtacgcattttcccctg
ttgaaagctcttatcggtggcgttgtgggacgtgaggtcacacttatctcgtcggcaaaa
gaagccgcacgcgatgtcgccgaggcgctgggacgacgcaatgcgcttgcgggcatagac
cgcgaaccgcgctacgacttctttaccacgggcgaggatatagacgagtttcgcagtttt
ggaagccgcgtgtttcgcacacccattgacaacgttgcgcatgttgatttgtcctaa

DBGET integrated database retrieval system