KEGG   Filifactor alocis: HMPREF0389_00745Help
Entry
HMPREF0389_00745  CDS       T01663                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
faa  Filifactor alocis
Pathway
faa00071  Fatty acid degradation
faa00280  Valine, leucine and isoleucine degradation
faa00310  Lysine degradation
faa00362  Benzoate degradation
faa00380  Tryptophan metabolism
faa00620  Pyruvate metabolism
faa00630  Glyoxylate and dicarboxylate metabolism
faa00640  Propanoate metabolism
faa00650  Butanoate metabolism
faa00900  Terpenoid backbone biosynthesis
faa01100  Metabolic pathways
faa01110  Biosynthesis of secondary metabolites
faa01120  Microbial metabolism in diverse environments
faa01130  Biosynthesis of antibiotics
faa01200  Carbon metabolism
faa01212  Fatty acid metabolism
faa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:faa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0389_00745
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF0389_00745
   00640 Propanoate metabolism
    HMPREF0389_00745
   00650 Butanoate metabolism
    HMPREF0389_00745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0389_00745
   00072 Synthesis and degradation of ketone bodies
    HMPREF0389_00745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF0389_00745
   00310 Lysine degradation
    HMPREF0389_00745
   00380 Tryptophan metabolism
    HMPREF0389_00745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0389_00745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF0389_00745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0389_00745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:faa04147]
    HMPREF0389_00745
Enzymes [BR:faa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF0389_00745
Exosome [BR:faa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0389_00745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: EFE28825
UniProt: D6GPX2
Position
complement(1380695..1381870)
Genome map
AA seq 391 aa AA seqDB search
MREVVIASAARTAVGSFGGAFKDVPAVDLGVCAAKEAIKRAGITPEQIEESYIGNVLSAA
LGQNVARQVSMGAGIPKEKPAMSINMVCGSGLRAVSLAAQLIGVGDADIILAGGTESMSM
APYAIPTSRWGARMGDKTIVDTMVNDGLTDAFNHYHMGITAENINEQWNITREEQDELAL
ASQLHAEAAQNEGRFDEEIAPFVVKTRKGEVVVDKDEFIKPGMTMEKLSKLKPAFKKDGS
VTAGNASGINDGAAMLVLMSKEKAEELGVTPLATIVSYASAGVDPSIMGIGPVPASKKAL
EKAGMTVDDIDLFEANEAFAAQSVAVVRELNIPREKLNVNGGAIAIGHPIGASGARILVT
LLHEMKRRDAKHGLATLCIGGGMGTALIVKR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgtaatagcaagtgcggcaagaacagcggtaggaagtttcggaggggca
ttcaaggatgttcctgcagtagatttgggagtttgtgcggcaaaagaagcaattaaaaga
gcaggtatcactccggaacaaattgaagaatcttatatcggtaatgtattgtctgcggct
ttgggacaaaatgtagcaagacaagtatcaatgggagcaggcattccaaaagaaaaacct
gcaatgagtatcaatatggtttgcggttcgggacttcgtgcagtttctttggcagcacaa
ttgattggtgtcggagatgccgatattatcttagcaggcggaacagaaagtatgagtatg
gcgccttacgcgattcctacttctcgttggggagcaagaatgggagataaaacaatcgta
gataccatggtaaacgatggtttgacagatgcttttaaccactaccacatgggaattaca
gcagaaaacatcaatgaacaatggaatatcacaagagaagagcaagatgaattggcattg
gcttctcagttacacgctgaagctgcacaaaacgaaggtcgctttgatgaagagattgca
cctttcgtagtaaaaacaagaaaaggtgaagttgttgtagataaagatgagttcatcaaa
ccgggaatgacaatggaaaaattgtcaaaattaaaacctgcatttaaaaaagacggttcc
gtaacagcaggtaatgcttccggaatcaacgatggagctgcaatgttggtattgatgtca
aaagaaaaagcggaagaattgggagtgacacctcttgcaacaattgtatcttatgcaagt
gcaggtgtagatccttccatcatgggaatcggaccggttcctgcaagcaaaaaagcattg
gaaaaagcaggaatgacagtagatgacatcgatttattcgaagcaaacgaagcatttgcg
gcacaatctgtagcagtagtaagagaactcaacattccgagagaaaaattgaatgtaaac
ggaggagcaattgcaatcggacaccctatcggagcatccggagcaagaatcttagttaca
ttgcttcacgaaatgaaacgccgtgatgcaaaacacggtttggcaacactttgtatcggc
ggaggaatgggaacagcacttatcgtaaaacgataa

DBGET integrated database retrieval system