KEGG   Filifactor alocis: HMPREF0389_01410Help
Entry
HMPREF0389_01410  CDS       T01663                                 

Definition
(GenBank) hypothetical protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
faa  Filifactor alocis
Pathway
faa00010  Glycolysis / Gluconeogenesis
faa00020  Citrate cycle (TCA cycle)
faa00620  Pyruvate metabolism
faa01100  Metabolic pathways
faa01110  Biosynthesis of secondary metabolites
faa01120  Microbial metabolism in diverse environments
faa01130  Biosynthesis of antibiotics
faa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:faa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0389_01410
   00020 Citrate cycle (TCA cycle)
    HMPREF0389_01410
   00620 Pyruvate metabolism
    HMPREF0389_01410
Enzymes [BR:faa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     HMPREF0389_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP DUF4914 AAA_33 Bombesin AAA_29 NB-ARC AAA_24 Arf ABC_tran AAA_22
Motif
Other DBs
NCBI-ProteinID: EFE27779
UniProt: D6GTH2
Position
complement(1047665..1049305)
Genome map
AA seq 546 aa AA seqDB search
MATIQKFERKNIKKENSKFSALRTTIETVFYGNNVVRINSLAEAYELAKKSSGTIVTDLP
VFRAEEIGLPSDAKILLYNDGVVTGRYAKGRVVIGHKDVDEKKYTGIAREAAFYAQGKKL
YYAQAYIGLHEGFMVNAHLIVEEGYENTLYNWLLNFQTKTEEYQAMYQSSQVLDETDIYV
LSLPNYIPQGHEKGLSLFDSNHNSLLLCGMRYFGEHKKGTLTLAWEIANRNGYVSCHGGL
KQYQLKDKEYTIAFFGLSGSGKSTLTHNTHQDKYEIRILHDDAFVISDKDKSTIALEPSY
FDKTQDYPMEDQANQYLISVQNCGATLDEEGRVVLVTEDIRNGNGRAIKSKFWTKNRVNH
MKEPVNAIVWLMRDSAIPPLLKIDNSVVASIFGATLATKRTTAERLDSAEEMEKLVIIPY
ANPFRTYSLGQDYHKFKALFEDGTTDCYILNTGHFMGKKIPKETTLHLLEQIVDGSISLE
SLGKLSHIQYAKIDGFLPNMEEENYQAAWENALNNRLQFVTEQKGTADELPEEVEIELNQ
LKNQVR
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccattcaaaaatttgaaagaaaaaatatcaaaaaagagaattcgaagttctct
gctcttagaacaaccatagagactgttttttatggaaataatgttgttaggataaattct
ttggcagaagcatacgaacttgcgaaaaagtcttccggaacgatagtgacagacttgccg
gtgttccgtgcagaagagataggacttccgtctgatgcaaaaattttgctgtacaatgat
ggtgtagtgacgggaagatatgcaaaaggtagagttgtgataggtcacaaggatgtcgat
gaaaagaaatatacagggattgcaagagaagcagctttttatgcacaagggaaaaaactg
tattatgcacaggcgtacataggattgcatgagggatttatggtgaatgcacatctcatt
gtagaagaaggatatgaaaacacgctgtataattggttgctgaattttcagacaaaaaca
gaagagtatcaggcgatgtatcaatcgtctcaagtattagacgaaacggatatctatgta
ctgtccttaccgaactatattcctcaagggcatgaaaaaggactgtctttgtttgattcg
aatcataattccttgttattgtgcggaatgcgttatttcggtgagcataaaaaaggaact
ttgactttggcatgggaaattgcaaacagaaacggttatgtttcttgtcatggaggtttg
aaacaatatcaattaaaggacaaggaatatacgattgcattcttcggattatccggttca
ggaaaatctaccttgacccacaatacacatcaagataagtatgagattcgcattttgcac
gatgatgcatttgttatttctgataaagacaagtctaccattgcattagaaccttcgtat
tttgacaaaacacaggattatccgatggaagatcaggcgaatcaatatttgatatcagtc
caaaattgcggtgccacattggatgaagaaggtcgtgttgtgttggtaacagaggacatc
cgaaacggaaacggtcgtgcaatcaaatctaaattttggacaaagaacagagtgaaccac
atgaaagaaccggtaaatgcaattgtttggttgatgagagacagtgcgattccaccactg
ttgaagattgacaactctgtggttgcatctatcttcggggcgacattggcaaccaagaga
acgactgccgaacgattggacagtgcggaagaaatggagaaattggtcattattccgtat
gcaaatccgtttagaacctactctttaggacaggattatcataagttcaaagcactcttc
gaagacggaacgacagattgctatattttgaacaccggacattttatgggtaaaaaaatt
ccaaaagagacaacgctacatctattagaacagattgttgatggaagcatatctcttgag
agtcttgggaaattaagccatattcaatacgcgaaaatagacggatttttgccgaatatg
gaagaagagaattatcaggcagcttgggagaatgcattgaacaaccgacttcagtttgtc
acagagcaaaaaggaacagcggacgaattgccggaagaagtagagatagaattgaatcaa
ttaaaaaatcaagtgagataa

DBGET integrated database retrieval system