KEGG   Ficedula albicollis (collared flycatcher): 101806039Help
Entry
101806039         CDS       T02815                                 

Gene name
PLK4
Definition
(RefSeq) polo like kinase 4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101806039 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101806039 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fab03036]
    101806039 (PLK4)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     101806039 (PLK4)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   101806039 (PLK4)
Chromosome and associated proteins [BR:fab03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101806039 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     101806039 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    101806039 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Haspin_kinase Kinase-like DUF4520 Kdo
Motif
Other DBs
NCBI-GeneID: 101806039
NCBI-ProteinID: XP_005044713
Position
4
AA seq 976 aa AA seqDB search
WLTKPQANEAGFFGLQDFKVGNLLGKGSFAGVYRAVSLKTGLEVAIKMIDKKAMHKVGMV
QRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLILEICHNGEMSRYIKNRKKPFSEDEAR
HFLHQIITGMLYLHSHGILHRDLTLSNILLTSNMNVKIADFGLATQLKMPHEKHYTMCGT
PNYISPEIATRSPHGLESDVWSLGCMFYTLLIGKPPFDTDTVRNTLNKVVLADYEMPAFL
SREAQDLIHRLLRKNPADRLSLSSVLDHPFMSRGSSARSRDLGTSEDSMDSGNATISTTF
TGSSSISTSGSLKEKKKLLVGQPLPNKITFFPTNKNSSNNSSGDGPGSFRQWGIQGKEAG
VSGRGRTMQPDEERPHSRYLRRAHSSDRSGTSHSQTQGISSIMDRCHSLEVLSKPKIGTK
ENTEYFSPANSYTDIGEIFKEKTSSTSGSFEEQISPPVKDQPHSNYLCQVKPQVGLLEQK
SQAEMMQQWLGSTQTNVPLRPPADLTGKSNAHGGFRYHLDLQQDAPRNAWNTLKDIRNQD
ASGDCPHSSNQRNPKTCIPGVLCKNEKIEPSPTCGLWSAPEQNQTWGQEPSAHQKPTLRS
VVSPLTAHRLKPIRQKTKNAVVSILDTGEVCMEFLKEHRSQELVKEVLRISCDGNVIAVY
HPNEGRGFLLDDRPPAPPEGICTYNFDNLPEKYWKKYQYAAKFVQLVRTKTPKVTFYTRY
AKCMLMENSPPADVEICFYDGTKIHKTAGITRVIEKSGKSFTLNGESEAGLKKEIQAYMD
HANEGHRTCLALESAILEEEKWSGSAPFFPIIVGRKPGNTESPQAVAPPLLDKTNYSKEV
VALDRNKAASSTPVQTPNCAPVVSCEKPMLLTNTVEKTCSSVHQMECSPNSAQLVKSVFV
KNVGWASQLTSGAVWVQFNDGSQLVAQAGVSSITYTSPDGQTSRYGEDDKLPEYIKEKLH
CLSSILVMFTNPAGPH
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
tggctgacaaagccccaggctaacgaggctggttttttcggcttgcaggatttcaaggtg
gggaacctcctggggaagggctccttcgcaggggtctacagagcagtatccctgaaaacc
ggcctggaagtggctatcaagatgatagacaaaaaagccatgcacaaagttggaatggta
cagagggttcagaatgaggtgaaaatacattgtcagctaaagcatccatctatactcgag
ctttataactattttgaagatagcaactacgtatacttgatacttgagatctgtcacaat
ggtgaaatgagcagatacataaagaacagaaagaaacccttttcagaagatgaagcgcga
cacttcttgcaccagattatcacgggtatgctgtacctccattcccatggaatattgcac
cgggacctcaccctctccaatatcttactcaccagtaacatgaacgtcaagattgctgac
tttggcttggcgactcagctgaagatgcctcatgagaagcattacaccatgtgtggaact
cccaattacatttctcccgagatagccacgaggagcccgcacgggctggagtcggacgtg
tggtctctgggctgtatgttctatacccttctcattggaaagccgccttttgacacggac
acggtcaggaacacgctgaataaagtggtgctggcagattatgaaatgccagccttcttg
tcgagagaggcacaggacctcattcacaggttactgcgcaaaaacccggcagatcgcttg
agtctttcctcagtgttggatcatcctttcatgtccaggggtagctctgcacggagcaga
gacttgggaacctcagaagattccatggacagtgggaatgccaccatctctacaaccttc
acgggctcttccagcatcagtaccagtggtagcttgaaggaaaagaagaagctgttagtt
ggacagccactcccaaataaaattactttttttcctacgaacaagaattccagtaataat
tcatcgggagacggacccggttctttccgacagtggggaattcagggaaaagaagctggt
gtaagtggcaggggaagaaccatgcagcctgatgaggagaggccacattcccgctacctc
cgaagagcccactcctcagacaggtctggcacatcccacagccagactcaaggcatttcc
agcatcatggatcgatgtcactctttggaagtgctttccaagcctaaaataggaacaaag
gaaaacacagaatacttttcacctgccaacagctatactgatataggagaaatatttaag
gagaagacttctagtacttctggttcttttgaagagcagatatccccacctgtaaaagat
caaccacactctaattatctgtgccaagtgaagccccaggttggtttgttagagcagaag
tcccaggctgagatgatgcagcagtggcttggaagcacgcaaacaaatgttcctctgaga
ccacctgcagacctgactggcaagagtaatgcacatggaggttttcggtaccatctggat
ctgcagcaggatgcaccaagaaatgcatggaacaccttaaaagatataaggaatcaggat
gcatctggtgactgtccacattcttcaaaccagagaaacccaaagacatgcatccctgga
gttctctgcaaaaatgagaaaattgaaccatctcctacatgtggcctttggtcagctcca
gaacaaaaccaaacttggggccaagaaccatcagcacaccagaaacctacactgcgaagt
gttgtgtcacctctcactgctcacaggctgaaacccatcaggcaaaaaaccaaaaatgca
gtggtgagcattctagatactggggaagtgtgtatggagtttctgaaagaacaccgctcg
caggaacttgtgaaagaagttctcagaatatcttgtgatggaaatgtgattgcagtttat
catccaaatgaaggaagaggtttccttcttgatgacagacctcctgctccccctgaaggc
atctgcacatataattttgacaacttgccagaaaagtactggaaaaaataccagtatgca
gctaagtttgtgcagttggtgagaacaaaaacccccaaagtgacattttatacaagatat
gccaagtgcatgttgatggaaaattcaccccctgcagatgttgaaatttgtttttatgat
ggaacaaagatccataagacagctggaataactcgtgtgattgaaaagtcagggaaatcc
ttcactttgaatggagaaagcgaagcagggttgaagaaggaaatccaggcttacatggat
catgcaaatgagggacatcgtacatgccttgcactggaatctgctattttggaagaagag
aaatggagtggaagtgctccattttttccaataattgttggaagaaaacctggtaatact
gaatcaccacaggctgtagcacctccactgttggacaagacaaactattcaaaagaagtt
gtggcattggatagaaataaagctgccagttctactccagttcagactccaaactgtgct
cctgtggtgtcctgtgaaaagcctatgcttctgactaacactgtggaaaagacgtgttcc
tctgttcatcaaatggaatgcagtccaaattcagcccaacttgtcaaatctgtttttgtg
aaaaatgttggttgggcttctcagctgaccagtggagcagtatgggttcagttcaatgat
ggatcccagctggtagcccaagcaggtgtctcttccatcacttacacttctccagatggc
cagacaagcaggtatggagaagatgataagttgccagaatacatcaaagagaagctgcac
tgtctgtcttctattcttgtaatgtttaccaatccagctggtcctcactga

DBGET integrated database retrieval system