KEGG   Ficedula albicollis (collared flycatcher): 101806434Help
Entry
101806434         CDS       T02815                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00564  Glycerophospholipid metabolism
fab01100  Metabolic pathways
Module
fab_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
fab_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101806434 (CHKA)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101806434 (CHKA)
    2.7.1.82  ethanolamine kinase
     101806434 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Helo_like_N Kdo
Motif
Other DBs
NCBI-GeneID: 101806434
NCBI-ProteinID: XP_005047019
Position
5
AA seq 335 aa AA seqDB search
MLFQCSLPDTIETVADEPRKVLLRLYGAILQMRSCNKGESVQSQKENDLQGAEAMVLESV
MFAILAERALGPKLYGIFPQGRLEEFIPSRKLNTEELSLPDISAEIAEKMARFHGMKMPF
NKEPKWLFGTMEKYLNQVLRIKFTRESQTRKLNKLLSYNLPQEMKNLRAMLEATSSPVVF
CHNDCQEGNILLLEGRENSENQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFF
KASVLKYPSKKQQLHFLSSYLSAFHDGFENLSNEEKSKLEEEVLVEVNRFALASHFFWGL
WSIIQAKISSIEFGYLEYALSRFDAYFDQKRKLKV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttcagtgctcgctacctgataccattgagacagttgcagatgaaccacggaaa
gttctcctgcgtttgtacggtgcaatcttgcagatgaggtcctgtaataagggagagtct
gtacagtctcagaaggaaaatgacttgcaaggggcagaagccatggttctggaaagtgtt
atgtttgccattcttgcagagagagcgcttggcccaaagctgtatggaatcttcccacaa
gggcgactggaggaattcattcccagcaggaaactgaacactgaagaactaagcttacct
gacatatctgctgaaatagctgagaagatggccagatttcatggcatgaaaatgccattt
aataaggaacctaagtggctttttggaacaatggaaaagtatctaaatcaagtgctgaga
attaaatttaccagagaatcccaaaccagaaaactcaacaaacttctcagttacaatctc
ccccaggaaatgaaaaatctaagagctatgcttgaagctacttcttcaccagttgtattt
tgccacaatgactgtcaagagggtaatatcttacttctggaaggcagagagaattcagaa
aaccaaaagctgatgctcattgactttgaatacagcagctataattaccgaggatttgat
attggaaatcacttctgtgaatggatgtatgattactcgtatgaaaagtacccattcttc
aaagccagtgttcttaaatatccttcgaagaaacaacagcttcatttcctctccagttac
ctgtctgcattccatgatggctttgaaaatctgagcaatgaagagaagtccaaactagaa
gaagaagtgttggtagaagttaacaggtttgcccttgcatcacacttcttctggggtctg
tggtctattatacaagcaaagatctcatccattgagtttgggtacctggaatatgcgtta
tccagatttgatgcctactttgatcagaagagaaagctgaaggtgtga

DBGET integrated database retrieval system