KEGG   Ficedula albicollis (collared flycatcher): 101807190Help
Entry
101807190         CDS       T02815                                 

Gene name
NT5C1B
Definition
(RefSeq) cytosolic 5'-nucleotidase 1B
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00230  Purine metabolism
fab00240  Pyrimidine metabolism
fab00760  Nicotinate and nicotinamide metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101807190 (NT5C1B)
   00240 Pyrimidine metabolism
    101807190 (NT5C1B)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101807190 (NT5C1B)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     101807190 (NT5C1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-GeneID: 101807190
NCBI-ProteinID: XP_016152514
Position
3
AA seq 355 aa AA seqDB search
MRGDPAGVCAATGETLREEAEQDWAAAKAFYDNQVTQRVRPPKPQNAITVAVSSRALFNL
VEEQRIYEEQGLEKYVEYQQNNENVILKPGPAFYFVKALERVNARLLELYPDDEERFDIV
LMTNNHAQVGVRLINSINHYGLTIERFCMTGGESPIGYLTAYLTNLYLSADCDKVQEAIE
AGIASATMFTANKDVVYSDTQLRVAFDGDAVIFSDESEQIFKQQGLDRFFEHEQLNENKP
LAQGPLKGFLEDLGKLQKKFYAKNERLNCPIRTYLVTARSAASSGARVLKTLRSWGLEID
EALFLAGAPKGPVLVKIRPHIFFDDQMFHIEGAQKLGTIAAHVPYGIAQKHQKST
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaggggagaccctgcgggtgtctgtgccgccacaggggagaccctgcgagaggaggcc
gagcaggactgggcggcggccaaggctttctacgacaatcaggttacgcagagagtccgg
ccgcccaagcctcagaatgccatcacggtggccgtgtcctcccgagcgctcttcaacctc
gtggaggagcagcggatctacgaggagcaggggctcgagaagtacgtggagtaccagcag
aacaacgagaacgtcatcctcaagcccggaccggcgttctactttgtcaaggcgctggag
cgtgtcaatgcccggcttcttgagctgtaccctgatgatgaggaacggtttgatattgtc
ctgatgactaataaccatgcccaggtgggagtgaggctcataaacagcatcaaccactat
ggcttaacaattgaacgtttctgtatgactggaggagagagccccattggttacctgact
gcatacctcacaaacctgtacctctcagcagattgtgacaaagtgcaggaagctatagaa
gcaggcattgcatcagctacgatgttcactgccaacaaagatgttgtttactcggataca
cagctgagggtggcttttgatggggatgctgttatcttttctgatgaatcagaacagatt
ttcaaacagcaaggattagatagattttttgaacatgaacagctgaatgaaaataagcct
cttgcacagggtcctttgaagggctttctggaagacctggggaaactccaaaagaagttc
tatgcaaaaaacgaacgattaaattgtcctataaggacctacctggtcacagccagaagt
gcggcgagctctggagccagagtgctgaagactctccgtagctggggtctggagattgat
gaggcacttttcctagcgggagcacctaaaggaccggtcctggtgaaaatccgccctcac
attttctttgatgaccagatgttccacattgaaggggcacagaaattaggcaccatagct
gcacacgtcccctatggcattgctcagaagcaccaaaaatctacatga

DBGET integrated database retrieval system