KEGG   Ficedula albicollis (collared flycatcher): 101808664Help
Entry
101808664         CDS       T02815                                 

Gene name
BST1
Definition
(RefSeq) bone marrow stromal cell antigen 1
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00760  Nicotinate and nicotinamide metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101808664 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fab04090]
    101808664 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fab00537]
    101808664 (BST1)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     101808664 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     101808664 (BST1)
CD molecules [BR:fab04090]
 Proteins
  101808664 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fab00537]
 Enzymes
  101808664 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 101808664
NCBI-ProteinID: XP_016153580
UniProt: U3K3V7
Position
4
AA seq 316 aa AA seqDB search
MMMSLFFPLLFFSVLCINSFSGVQGKKWKGEGTTQNLESIVIGRCYDYIRIVNPAVGEKN
CSQIWEAFKNAFINKDPCSILPEDYELFINLTLHMIPPNKSLFWENNQLLVNSFADRGRR
FMSLGDTLFGFVADFLYWCGQADSPGLDYESCPTTVECENNAVESFWRMASITYAHHSSG
VIHVLLNGSADGGAYPQPGFFADYEIPNLQRGKISQIVIWVVDDIEGPDIDSCGAHTVKT
LETRLKTLGYDVTCTDNNKSVMFLLCLDNPDDSKCALASSAPAAQRGPISSDRGGSWNKL
MFVSFASFLFRFASVF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgagcctttttttccctcttttatttttctctgttctgtgtattaatagcttc
tcaggagtgcagggaaagaaatggaaaggtgaaggtactactcaaaacctggaaagtatt
gtcattggaagatgctatgattatattagaattgtgaaccctgctgttggtgagaagaat
tgttcacagatatgggaagcatttaaaaatgcatttattaacaaggatccttgcagcatt
ctacctgaggattatgaattatttatcaacctcacattgcacatgattccacctaacaag
tctcttttctgggaaaataatcagctgttagtcaatagctttgctgacagaggacgtcgc
ttcatgtctctgggtgatactctgtttggcttcgttgcagattttctctactggtgtggg
caggcagacagccctggactggactatgaatcctgccctaccacggtggaatgtgaaaac
aatgcggtggaatctttctggaggatggcctcaatcacttatgcacatcacagctctggg
gtgatacatgtcttgctgaatggttctgcagatggaggagcttatccacagccaggtttt
tttgcagattatgaaatacctaatctccagagaggcaaaatttcacaaattgtcatttgg
gttgtggatgatattgaaggacccgatatagattcctgtggagctcatactgtgaaaaca
ttagaaactaggctgaaaactctcggttatgatgtcacttgtactgacaataacaagtct
gtaatgttcttactctgcctggataatcctgatgattctaaatgtgcccttgcatcatct
gcaccagcagcacaaagaggacctatatcttcagacagaggaggcagctggaacaagctc
atgtttgtttcttttgcaagctttttgttcagatttgcttcagtgttctaa

DBGET integrated database retrieval system