KEGG   Ficedula albicollis (collared flycatcher): 101809354
Entry
101809354         CDS       T02815                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fab01002]
    101809354 (ADAMTS13)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101809354 (ADAMTS13)
Peptidases and inhibitors [BR:fab01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101809354 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 TSP1_CCN Reprolysin_3 Reprolysin_5 Reprolysin_2 Pep_M12B_propep Peptidase_M10 Semialdhyde_dhC DUF3810 Fve
Other DBs
NCBI-GeneID: 101809354
NCBI-ProteinID: XP_005055680
UniProt: U3JFN6
Position
17
AA seq 1398 aa
MTVSLALRALAVLPLGLCWLPEKFLGALDAEDVLSYFGNSSVADVPEFVVAEPTCPCKEE
HFGLEPCPVQHCSIQAWGQLYAVEFLEDHALLSSSFVSSQVVNSSFILLKRFPGNCFAGG
KSLQPPGARSRVTFCEGQLQGVITVGEEKIHIRPVRSKDVALLKDLGFSSPHILFKSAAR
EAKPARAGWAPPRLHKRAEAAVKHLELMVVAGPDVYLYHKEDTERYILANLNIGAELLRD
ASLGAHFRVHLMQMLVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVLY
ITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIAHDGE
GNLCSSSGYIMGSAGNHNSIDLTWSPCSQEQFLALVSTGQTSCLNDLPDMDGSIPGWKPG
LYYGADEQCKIAFGSLATACTFADSNVDICKVLSCHVQPADKSSCTRLLVPLLDGTECGI
NKWCSKGQCSSLEELNPMAVVHGHWSAWSPLSPCSRSCGGGVLLRQRFCNNPRPAFGGQE
CHGASMQAEMCNTQACLMTQQDFMAEQCAATNLKPLYLDVETPSFYTWTSAVGFAKGDLL
CKHMCRAVGKEFMVSRGDNFLDGTRCEQDDMEHHGDLHLCVMGRCRAFGCDGQMGSRKAM
DPCKVCGGDNSTCTKVRGSYTEGKAQEYVTFLSLPYNTTSVHVTNRRPLFTHLAVKVKGE
YVVAGKGKISQNVTYPSVLEDKQIKYRVFLTQDSLPSLEEIHVDGPTQEEIEIQVYRRYT
KEYGNATNPDITFSYFVPKENLTYLWIPQQGPCSVTCGEGVQPVTHVCFDQTKHEVTEDQ
RCLELPQPLPEHKPCAMEPCLYRWKMSQRGECSAVCGTGAAQQNLTCVQYHDGLETVVDD
SLCPAEEKPLSLVPCVVNVCPLGWDKEEDAHSPQPLESLGHVQQQNQTVYVWSPVAGECS
VSCGRGHAQLHYVCVAFDTKEETQEENCQPVPKPESRVEVCDLNPCPPRWKVTPAGPCSS
SCGLGLAVQLVTCVQILHGQEVLQEEHLCPAAEKPLTSVPCVIRTCSYEWSFSEWSQCST
SCGNGIQTRKDFCLSSLTHKPVNPLFCRRFPKAVVVRGCSAGPCPEHEGTLSPGAELQPV
TAATHLSTPAAATEHRHKELDVPLSAGPPEQTKPGGGVCGNLFLNATGIINMTGVESRDC
TVAIGRPLREEISVTVLESSLNCSAGEILLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQ
RVVLPGNGVILQYSSRTAAKKYYQDCDQQLFGPQGEIVNPVQLPEERQALVCRTFITVAP
RQRISIRALHTDLGPEGNHTHFNYILVRDVSTMKTVVFHGKQQFLWQSTGSQAEIEFHEN
VKDHRTHFWAEYHAIEPN
NT seq 4197 nt   +upstreamnt  +downstreamnt
atgaccgtcagcttggcgctgcgggcgctcgccgtgctcccgctggggctgtgctggctc
cccgagaaattcctcggcgctttggatgcggaagatgttttgtcttactttggaaacagc
tcagtggctgatgtacctgagtttgttgtggctgagccaacttgcccttgtaaagaagaa
cattttgggttggagccctgtccagttcagcactgctccatccaggcctggggccagctc
tatgccgttgaattcctagaggaccacgccctcctttcctcctcctttgtgagcagccag
gtggtgaactcttcctttattttactgaagaggttcccagggaactgctttgcaggtgga
aagtccctgcagcctcctggggccaggagcagagtcactttttgtgaagggcagctgcaa
ggagtcatcactgtgggtgaggagaaaattcacatcaggccagtcaggagcaaagatgtg
gctctgctgaaggatcttggcttctccagtccccacatcctcttcaaaagtgctgccaga
gaggcaaagccagccagagcagggtgggctcctcctcgcctgcacaagagggctgaggca
gctgttaaacatctggagctgatggtggtggcagggccagatgtttatttgtaccacaaa
gaggacacagagagatacatcctggccaacctgaacattggagcagagctgctcagagat
gcctcactaggggctcatttcagagttcacctgatgcagatgctggttttgagagagcca
gaggcagaggtgaacatcacaaccaacatcacctcctccctcatcagtgtctgtgagtgg
agcaagaaggtgaacccccagaacgactctgacccccagcatgctgacattgtcctctac
atcaccaggtttgacctggaattgcctgatgggaacaaggagcttcgtggagtgactcag
ttagggggagtctgctcctccttctggagctgtgtcattacccaggacactggctttgac
cttggagtcaccatagcccatgagattgggcacagccttggcattgcccacgatggagag
gggaatctgtgcagcagcagtggttacatcatgggctcagcaggaaaccacaacagcatc
gacctcacctggtctccgtgcagtcaggagcagttcctggcccttgtcagtacaggccaa
acaagctgcttgaatgacctgccggacatggacggcagcatcccggggtggaagcctggc
ttgtactacggagcagatgagcagtgtaaaattgcctttggcagtctggccacagcttgc
acctttgctgacagcaatgttgacatctgtaaagttctctcatgccatgtacaaccagct
gacaaatccagctgtactcggcttctggttcccctcctggatggaactgagtgtgggatc
aacaagtggtgctccaagggtcagtgcagctctctggaggaactgaaccccatggctgtg
gtccatgggcactggtctgcctggagccccctgtccccctgctcccgcagctgtggtggg
ggggtgctgctgaggcagcgcttctgcaacaaccccaggcctgcttttggggggcaggag
tgccacggtgccagcatgcaagcagagatgtgcaatacacaggcctgtctgatgacccag
caggacttcatggctgaacaatgtgcagcaacaaatttaaagccactgtaccttgatgta
gaaacaccatccttttatacctggacctctgctgttggctttgccaaaggggacctgctc
tgcaagcacatgtgcagggctgtgggcaaggagttcatggtgagccgtggggacaatttc
ctggatggaaccaggtgtgagcaggatgacatggagcaccatggggatctccacctgtgt
gtgatggggagatgcagagcattcgggtgtgacggccagatgggctccaggaaggccatg
gatccctgcaaggtctgtgggggtgataactccacttgcaccaaagtgaggggatcctac
acagaagggaaagctcaagagtatgtgacgtttctgtccctgccctacaacaccacctcg
gtccatgtcaccaacaggaggcctctcttcacacacctggctgtgaaggttaaaggagag
tatgtggtggctggaaaaggaaaaatctcacagaatgtcacctacccatcagttctggag
gacaagcagatcaaatatcgagtgttcctcacccaggacagcctgccaagcctggaggag
atccacgtggatgggccaacacaggaagaaattgaaatacaggtctacaggaggtacaca
aaggaatatggcaatgccaccaacccagacatcaccttcagctactttgtccccaaggag
aacctgacctatctgtggattcctcagcagggcccgtgttcagtgacctgtggggaaggg
gtgcagccagtgactcacgtgtgctttgatcagaccaagcatgaagtaacagaggatcag
aggtgtctggagctgccacagcccctcccagagcacaagccctgtgccatggagccttgc
ctctacaggtggaagatgtctcagagaggtgaatgctctgctgtctgtgggactggagct
gcccagcagaacctgacctgtgtgcagtaccatgatggcctggagactgtggtggatgac
agcttgtgcccagcagaagaaaaacccctctcccttgtgccatgtgtggtcaatgtctgc
cctttgggctgggacaaagaggaagatgcacactcacctcagcctctggagtcacttggg
catgtccagcagcaaaatcagactgtgtatgtctggagccctgtagctggggagtgttct
gtctcctgtggtagaggtcatgctcagctgcactatgtttgtgtggcttttgacaccaaa
gaagaaacccaggaggaaaactgccagccagtgccaaagccagagagcagggtggaagtc
tgtgatctcaacccctgcccaccaaggtggaaggtaaccccagctgggccctgctcctcc
agctgtgggctgggcttagcagtgcagctggtcacctgtgtgcagatcctccatggccag
gaggtcttgcaggaggaacatttgtgccctgcagcagagaagcccctcaccagtgtcccc
tgtgtcatccgaacgtgctcctacgagtggagcttcagcgagtggtcacagtgttcaaca
tcctgtgggaatggcattcagaccaggaaggatttctgcctcagctctctgacccacaag
cccgtgaacccccttttctgccggcgcttccccaaggctgtcgtggtgcgtggctgctct
gcagggccctgtcctgagcacgaagggaccctgtcccctggggcagagctgcagccagtg
acagcagccacacacctgagcacacctgcagctgccacagagcacagacacaaggagctg
gatgtccctctgtctgctgggcccccggagcagacaaagcctggtggaggtgtgtgtgga
aacctctttctcaatgccactggcatcatcaacatgacaggcgtggagagcagggactgc
acggtggccatcgggcgtcccctgcgggaggagatctcggtcaccgtcctggagagctcc
ctcaactgcagtgcaggtgagatcctgctgttttctgggcgaatgatgtggcggacaggc
tgcaggaagctccctctgtcactgataaattccagaaccaacacactgattgtgaaacag
cgtgttgtgctgccaggaaacggggtcatcctgcagtacagcagcagaactgcagccaaa
aaatattaccaagactgtgaccagcagctgtttggcccccagggtgagatagtgaatcct
gtgcagctgcccgaggagaggcaggcgctggtgtgccgcactttcatcacggtggctccg
cggcagcgcatctccatccgcgccctccacaccgacctgggccctgagggcaaccacaca
cacttcaactacatcctggtccgagatgtcagcaccatgaagacagtggtgttccatggg
aagcagcaattcctctggcagtcaacaggaagccaagctgaaattgaattccatgaaaat
gttaaggatcacagaacccatttctgggctgaatatcatgctattgagcccaactaa

DBGET integrated database retrieval system