KEGG   Ficedula albicollis (collared flycatcher): 101809406Help
Entry
101809406         CDS       T02815                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101809406
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101809406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 101809406
NCBI-ProteinID: XP_005049677
UniProt: U3KGG9
Position
7
AA seq 312 aa AA seqDB search
MWVFEEIINGRKLSEIINQEHENVKYLPGYKIPHNVVAVPDVAEAANGADILVFVLPHQF
IGRICEQIVGQIKPGTFGISLIKGIDEGPDGLKLISDLIREQLKIEISVLMGANIAKEVA
DEKFCETTIGCKNETQGEIFKELMQTPNFRITVVLDSDTVELCGALKNIVAVGAGFCDGL
SFGDNTKAAVIRLGLMEMVAFAKMFCKGPVSTATFLESCGVADLITTCYGGRNRKVAEAF
ARTGKSIEELESEMLNGQKLQGPQTSAEVYKILKQKNMLHKFPLFTTIYKICYEGRSIQE
FIMCLQNHPEHM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgtttgaagagatcatcaatggaagaaaactctcagaaatcatcaaccaggaa
catgaaaatgttaaatatctgcctggatacaagataccccacaatgtggtggctgtacca
gacgtggctgaagcagcaaacggggcagatattttagtgtttgtactgccacatcaattt
attggacgaatctgtgagcagattgtaggacagataaaacctgggacatttgggatttcc
ctgatcaaggggattgatgagggtcctgatggcctgaagctcatctctgacctcattcga
gagcaactgaaaatagagatcagtgtgctgatgggggccaacatagccaaagaagtggct
gatgagaagttctgtgaaaccaccattggatgcaaaaatgaaacccaaggcgaaatcttt
aaagaattaatgcagacccccaatttcaggattactgtggtgcttgactctgatacagtg
gagctttgtggagccttaaaaaacatcgtggcggtgggcgcggggttctgcgatggactg
agtttcggggacaacaccaaggcagcagtgatacgcctgggcctcatggagatggtggcc
tttgccaagatgttctgcaagggaccagtgtcaacagccacctttttggaaagctgtggg
gttgctgatctcatcaccacctgctacgggggacgcaacagaaaagtagcggaagccttt
gctcgcacaggaaaatccattgaggagctggaaagtgagatgctgaatggacaaaagctg
caaggtcctcagacctcagccgaagtctacaaaattctgaaacagaaaaatatgcttcat
aagtttccattatttacaactatctacaagatctgctacgagggtcgatctatccaggag
ttcatcatgtgcctgcagaaccacccagagcacatgtag

DBGET integrated database retrieval system