KEGG   Ficedula albicollis (collared flycatcher): 101809954Help
Entry
101809954         CDS       T02815                                 

Gene name
B4GALT4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00533  Glycosaminoglycan biosynthesis - keratan sulfate
fab00601  Glycosphingolipid biosynthesis - lacto and neolacto series
fab01100  Metabolic pathways
Module
fab_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    101809954 (B4GALT4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101809954 (B4GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fab01003]
    101809954 (B4GALT4)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     101809954 (B4GALT4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     101809954 (B4GALT4)
    2.4.1.-  
     101809954 (B4GALT4)
Glycosyltransferases [BR:fab01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   101809954 (B4GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2 Viral_Beta_CD Phycoerythr_ab
Motif
Other DBs
NCBI-GeneID: 101809954
NCBI-ProteinID: XP_005038668
UniProt: U3JU76
Position
1
AA seq 352 aa AA seqDB search
MALGLNVFNLFYKFKVLVLVTLFVMVLWTAFIYLVDTRQEIAKAKSMVEFFRKVTSLEHS
QKEEKIESTADVPMVKSFQGPCPALSPYLRGASKLSFKPLVTLEEVQKKNPLVAKGRYHP
VECSALQHVAILIPHRNREKHLLYLLQHLHPFLQRQQLDYGIYVIHQAGNTKFNRAKLLN
VGYLEALKEVNWDCFIFHDVDLVPENDFNIYMCDTQPKHLVVGRNNTGYRLRYRGYFGGV
TALTREQFSKVNGFSNNYWGWGGEDDDLRIRVEMQKMKVVRPPADVARYTMIFHNRDHGN
EENRERMKLLRQVSRTWKTDGLNSCSYKLLSVEHNPLYINITVDFSVQPKVS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggccttgggcttgaatgtttttaacctcttctataagttcaaagtgttggtgcttgta
actttatttgtgatggtgctatggactgcattcatttacttagtggacaccagacaggaa
attgctaaagctaagagcatggtggagtttttcaggaaggtaactagcctggagcacagt
caaaaggaagagaagattgaatccactgcagacgttcccatggtgaagtcatttcagggt
ccctgcccagctctgtctccatacctgcgaggtgccagcaaactctccttcaaaccattg
gttacactggaagaagtgcaaaagaagaaccctctggtagccaagggccggtaccaccct
gtggagtgctcagccctgcagcatgtggccatccttattccacaccgcaacagagagaag
catctgctgtacctcctgcagcatctccaccccttcctgcaaaggcagcagctggattat
ggcatctacgtcattcaccaggctggcaacaccaaatttaatcgagccaaactgctgaat
gtaggatacctagaggccctaaaagaagtgaactgggactgtttcattttccatgatgtg
gatctggtgccagaaaatgactttaacatttacatgtgtgacacacaaccaaagcacctt
gtagttggcaggaacaatactggatacaggttacggtaccgggggtattttggaggcgta
actgctcttacaagagagcagttttccaaagtgaatggattctctaacaactactggggt
tggggtggagaagatgatgaccttcgaatcagggttgagatgcagaagatgaaagtggtg
aggccgcctgctgatgtggccaggtacacaatgatcttccacaaccgtgaccacggtaac
gaggagaatcgagagaggatgaagcttctccgccaggtctctagaacatggaagacagat
gggctgaattcctgttcctataaactgctctctgtggaacacaacccactgtacatcaac
atcacggtggacttcagtgtacagcctaaggtctcatag

DBGET integrated database retrieval system