KEGG   Ficedula albicollis (collared flycatcher): 101810086Help
Entry
101810086         CDS       T02815                                 

Gene name
ST6GAL2
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00510  N-Glycan biosynthesis
fab00514  Other types of O-glycan biosynthesis
fab01100  Metabolic pathways
Module
fab_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101810086 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    101810086 (ST6GAL2)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     101810086 (ST6GAL2)
Glycosyltransferases [BR:fab01003]
 Terminal extension
  Sialyltransferase
   101810086 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 101810086
NCBI-ProteinID: XP_005037578
UniProt: U3JLT4
Position
1
AA seq 558 aa AA seqDB search
MKLSRRGICIQVSYSFTNTSRHKGAGKGIAMKPNLKQWKQLMLFGIFAWGLLFLVIFIYF
TDSNTAEPVPSSFSYIETKRLLPLQGKQRVIMGAIHDPSFSETIDGNEVLLNEDLIGTFK
SGTGNSKKWTVLEEAFRNEDEFFPPQLGRKSKSAFYQGNDDYLFAAGQPSHHHLQEIEKF
ISADMNNPKGNILQNNWSHQRRMRRRSTKHRRGQMLDESDDWDGLYSTMSKSFLYKLWKG
DVSSKMLNPRLQKAMKDYLSTNKHGVRFKGKRNSKLTGDQLFCELKERVNVKTIDGKEAP
FSTLGWEKHVPQIPLGKLYTHGFGSCAVVMSAGAILNSSLGDEIDSHDAVLRFNSAPTRG
YEKDVGNKTTMRIINSQILTNPNHHFVDSSLYKDVILVAWDPAPYSANLNVWYKKPDYNL
FTPYVQHRRKNPTQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILIMMSMCSE
VHVYEYIPSVRQTDLCHYHELYYDAACTLGAYHPLLYEKLLVQRMNKGLQDDLYRKGKVI
LPGFKAVKCPKRSDFSHL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttccaggcgtggtatctgcatccaggtttcatattccttcaccaatacttcg
aggcacaaaggagctggtaaaggcattgccatgaaaccaaacttgaagcaatggaaacaa
ctcatgctgtttggtatctttgcatggggtctgcttttcttggtgatattcatctatttt
acagatagcaacactgctgaaccagttccaagttccttttcttacattgaaactaagaga
cttctgccccttcagggcaagcagagagtcatcatgggagccatccatgacccatcattc
tctgaaaccattgatgggaatgaggttcttcttaatgaagatctcataggtacttttaaa
tcagggactggaaattctaagaaatggactgtattggaagaggcctttagaaatgaagat
gagttttttccaccccagttaggaagaaaatcaaaaagtgctttctaccaagggaacgat
gattatttatttgctgctggtcagccgtcacaccaccaccttcaagagatagaaaaattc
atttcagctgacatgaataatccaaaaggaaatattttacagaacaactggagccatcag
agaagaatgaggagaaggagcacaaagcataggagaggccagatgcttgatgaatctgat
gactgggatgggctgtattccacaatgtcgaaatcctttctttacaagctttggaaaggg
gatgtctcttccaagatgctaaaccctcgactgcagaaggcgatgaaagattatttgagt
accaataagcatggggtgcggttcaaggggaaacgaaactccaagttgacaggagaccag
ctattctgtgagctaaaagaaagagtgaatgtgaaaacaatagatggcaaggaggctccc
ttctccactcttggatgggaaaagcacgttccccaaattccactgggcaaattatataca
catggctttggaagctgtgcagtagttatgtctgctggtgcaatactgaactcctctcta
ggggatgaaatagattctcatgatgccgttttaagatttaattctgctccaacacgtggc
tatgaaaaagatgttggaaataaaacaaccatgcggatcattaattctcagattctcacc
aatccaaaccatcactttgtcgacagctccttgtataaagatgttatcttagtagcctgg
gatcctgctccctactctgcaaatctgaatgtgtggtataagaagccagactacaatctg
ttcactccctacgtacagcatcgcaggaagaatccaacccagccattctacatcctccat
ccaaagtttatatggcagctctgggacatcattcaggagaacactaaagagaagatacag
cccaaccctccttcttcagggtttattggtatcctgatcatgatgtccatgtgcagtgag
gtgcacgtgtacgagtacatcccctcggtgcggcagacagacctgtgtcactaccacgag
ctctactacgacgcagcttgcaccttaggggcttaccacccactgctctacgagaagctg
ctggtgcagaggatgaacaaaggtctgcaggatgatctgtatcgcaaggggaaagtcatt
ctgccagggttcaaagctgtcaagtgccccaaacgaagtgatttctcacacttgtag

DBGET integrated database retrieval system