KEGG   Ficedula albicollis (collared flycatcher): 101810292Help
Entry
101810292         CDS       T02815                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    101810292
Enzymes [BR:fab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     101810292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 101810292
NCBI-ProteinID: XP_005046305
Position
4A
AA seq 569 aa AA seqDB search
MGKCSPPRLGPGDSALCHNPLKPSGGRDGSSAPGQTQLQTVLGKHQTQLQTVLGKHPPRP
GQSSGQGEWWVSVSADGRGADQRNFGPTLTRCPCPLGVPCAVVARSAPQESVTGSFASFI
HGARPEHLSQTVRQRSKRMILDSIGVGLVGSTTRVFDIALRYCRELYSSVAVSSVYGKPG
VKLSPTLAAFTNGVATHSMDFDDTWHPATHPSGAVLPALLAASQMLPPNTKPNGLEFLLA
FNVGLEVQGRLMHFSTEAHDIPKRFHPPSVVGTLGSAAAAAKLLSLSSAQCCHALGIAAS
LAGAPMANAATQAKPLHVGNATRLGLEAALLAARGMEANPLILDDIPGCSGFSAFYSVYH
PKPLSAPGGHHEFLLEKQDIAFKRFPAHLGMHWVVDAALSVRNLFVNYAGSFSPSLIRTI
VLKIPVSKYINRPFPSSEHQARHSFQFNACAALLDGEVGLGSFSESSIQRQELRELLGKV
VVEHPEDNVANFDKMYGEVALLLHSGDVLTGKCDTFYGHWRKPLSKESLLKKFRSNASHV
LPEEKIEAIITLVDNLENLSDSSQLACSL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtgcagccccccacgcctggggccgggggactcggcgctgtgtcacaatccg
ctcaaacccagcgggggtcgggatggttcatcagccccaggccagacacagctacagaca
gtcctgggcaagcaccaaacacagctacagacagtcctgggcaagcatccacctcggcca
ggccagagctcaggtcagggtgagtggtgggtctcagtctctgctgatggtcgtggggca
gatcagagaaacttcggaccgactctcacacgctgtccttgtcccctcggtgtcccctgt
gcagtggtggcccgcagcgctccgcaggagtccgtgaccggcagcttcgcctccttcatc
cacggggctcggcccgagcacctgtcccagaccgtgcggcagcgcagcaagaggatgatc
ctggacagcatcggcgtggggctggtgggcagcaccacgcgggtgttcgacatcgcgctg
cgctactgccgggagctgtactcctccgtggccgtcagctccgtctatggcaagcccggg
gtgaagctgtccccgaccctggctgccttcaccaacggcgtggcgacccattccatggat
tttgacgacacgtggcaccctgccacccacccctccggggccgtgctcccggctctcctg
gcagcttcccagatgctgcctcccaacaccaaacccaacggcctggaattcctgctggcc
ttcaacgtgggcctggaagtgcaagggaggctcatgcacttctccaccgaggctcacgac
attcccaaaaggttccaccctccctcggtggtgggcaccctgggcagcgccgcggccgcg
gccaagctgctgtccctcagctctgcccagtgctgccacgccctgggcatcgccgcctcc
ctcgccggggcgcccatggccaacgccgccacccaggccaagcctctccacgttgggaat
gccacccgcctgggcttggaggccgctctgctggcggcccgagggatggaggccaacccc
ttgatcctggatgatattcccggctgctcggggttcagcgccttctacagcgtctaccac
cccaaaccgctgtcggcgcccggagggcaccacgagttcctcctggaaaagcaggatatt
gccttcaagaggttcccagcccacctgggcatgcactgggtggtggacgctgctttgtcc
gtccggaatctcttcgtcaactacgcggggtccttctccccgtcgctgatccgcaccatt
gtgctgaagatcccggtgtccaagtacatcaaccggcctttccccagctcggagcaccag
gcaaggcactccttccagttcaacgcctgcgctgccctgctggatggcgaggtgggcctg
ggctccttctccgagagcagcatccagcggcaggagctcagggagctgctgggcaaggtg
gtggtggagcaccctgaggacaacgtggccaactttgacaagatgtacggagaggtggcc
ctgctcctgcacagcggggacgtgctgacgggcaaatgtgacactttctacggccactgg
aggaagcccctgagcaaagagtcactcctgaagaagtttcgatccaacgcctcccacgtg
cttccagaagaaaaaatagaagccatcatcactctggtggacaacctggagaacctgtca
gacagctcccagctggcctgcagcctgtga

DBGET integrated database retrieval system