KEGG   Ficedula albicollis (collared flycatcher): 101810753Help
Entry
101810753         CDS       T02815                                 

Definition
(RefSeq) arylamine N-acetyltransferase, liver isozyme-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00232  Caffeine metabolism
fab00983  Drug metabolism - other enzymes
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101810753
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101810753
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101810753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 101810753
NCBI-ProteinID: XP_005052406
UniProt: U3KIP8
Position
11
AA seq 296 aa AA seqDB search
MNIQEYFGRISYNKPHKDADLQTLTAIFQHHIQTIPFENLSMHCGEPIELDLQATYNKIV
RKKRGGWCLEINHLLFWALQELGYEVCILGANSYEPAEKGYTAEINHILLKVVIQGDSYI
VDAGFGGAYQMWQPLMLISGKDQPQVPGIFHLMEDDGTWYLEKVKRKHYIPEPRNNDIPD
TPDLGNIRKIYRFTLEPRHIDDFQELNEYLQVSPDNILRKKSICTLQTTNGLLALVGWSL
TEMKYNYKEDTDLVNITTLTDEEVEKTLKDKFNIVLENKLVPVNVRGLPPNLVDQI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaggagtattttggaagaatatcttacaacaagccccataaggatgcagac
ttgcagaccctgacagccattttccagcatcacatccagaccattccttttgagaacctc
agcatgcattgcggggagcccatcgagctggatttgcaggctacttacaataagattgtg
agaaagaaacgtggtggatggtgcctggaaatcaaccacctcctcttctgggccctgcag
gaattaggctatgaggtctgtattcttggtgcaaacagctatgaaccagcagagaaggga
tacactgctgagattaaccatatcctgctgaaggtggtgatccagggagattcctacata
gtagatgctgggtttggtggtgcctaccagatgtggcagccactgatgctgatttctggc
aaggatcagccccaggtccctggcattttccacctcatggaagatgacggcacctggtac
ttggagaaagtcaaaaggaagcattatattcctgagcccagaaataatgacatccctgat
actccagacctgggaaatatccgaaaaatatatagatttactctggagccacggcacata
gatgacttccaggagctaaatgagtacctccaagtgtctccagacaacatcctgaggaag
aagtcaatctgcactctccaaaccaccaacgggctccttgccttagttggatggagcctc
actgagatgaagtacaactacaaggaggacacggacctggtgaacatcacaacccttaca
gatgaagaggttgagaagacgctgaaagataaattcaatatagtactggagaacaaactt
gtaccagtcaatgttcgtggcttgccacctaatttagtggatcagatctaa

DBGET integrated database retrieval system