KEGG   Ficedula albicollis (collared flycatcher): 101811376
Entry
101811376         CDS       T02815                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00230  Purine metabolism
fab00240  Pyrimidine metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101811376 (DCK)
   00240 Pyrimidine metabolism
    101811376 (DCK)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101811376 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33
Other DBs
NCBI-GeneID: 101811376
NCBI-ProteinID: XP_005044557
UniProt: U3K130
Position
4
AA seq 257 aa
MATPPKRSRHDGRLKKVAVEGNIAAGKSTFVNILKQASEEWEVVPEPVARWCNVQQSSGD
DCEELSTSQRSGGNVLRMMYEKPERWAFTFQTYACLSRVRAQLKALQGRAQHAQDPVLFL
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWINKQFGSRLALDGIIYLRATPEKCL
NRIYSRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFDYLQEIPILTLDVNEDFKGQK
DRYDHMIEKVKEFLSML
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagcgcagcaggcacgatggccgcctcaagaaggtcgccgtggag
ggcaacatcgctgcggggaaatccacctttgtgaatatcctgaaacaagccagcgaggag
tgggaagtggttcccgagcctgtcgctagatggtgcaatgtccagcaaagctctggagac
gattgtgaggagctgagcacgtcgcagcggagcggcgggaacgtgctgcgcatgatgtac
gagaagccggagcgctgggcgttcaccttccagacgtacgcgtgcctcagcagggtccgg
gcgcagctcaaggccctgcagggcagagcgcagcacgcgcaggatcccgtgctgttcttg
gagcgctccgtctacagcgacaggtacatctttgctgctaatttatatgagtctgactgc
atgaacgaaactgagtggacaatttaccaggactggcacgactggataaataagcagttt
ggctcaaggctggcactggatgggatcatttatctccgagccactcctgagaaatgtttg
aataggatttactcgcgtggaagagatgaagaacaagaaatccccattgaatatctggag
aagcttcactacaaacatgaaagttggctgcagcacaggacactgcgaacagattttgac
tatctgcaggaaattccaattttaacacttgatgttaatgaagacttcaaaggccaaaag
gacagatacgatcacatgatcgaaaaggtcaaggaatttttgagcatgttgtaa

DBGET integrated database retrieval system