KEGG   Ficedula albicollis (collared flycatcher): 101811896Help
Entry
101811896         CDS       T02815                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00350  Tyrosine metabolism
fab00360  Phenylalanine metabolism
fab00380  Tryptophan metabolism
fab01100  Metabolic pathways
Module
fab_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
fab_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101811896 (DDC)
   00360 Phenylalanine metabolism
    101811896 (DDC)
   00380 Tryptophan metabolism
    101811896 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101811896 (DDC)
Enzymes [BR:fab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101811896 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     101811896 (DDC)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101811896 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101811896
NCBI-ProteinID: XP_005041770
UniProt: U3JYJ5
Position
2
AA seq 485 aa AA seqDB search
MDAAEFRKRGKEMVDYVADYLEKIEKRQVFPDVEPGYLRPLIADCAPQDPESFEDVFKDI
EKIIMPGVTHWHSPYFFAYFPAACSFPALLADMLCGGIGCVGFSWAASPACTELETVMLD
WLGKMVNLPEEFLAGKDGQGGGVIQGSASEATLIALLAARTKTIKQVQSEKPELTEAEIM
GRLVAYASDQAHSSVERAALIGAVKIKSVPSDETFSVCGSALKKVLDEDKAAGLIPFFFC
ATLGTTPCCSFDKLLELGPICNKENIWMHIDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRSDLIGAFKLEPLYLQHHHQESGLVTDYRHWQIPLGRRFRSL
KLWFVLRMYGVKGLQEHIRKHIRLSHQFEHLVLQDERFEICAEVVLGLVCFRLKGSNELN
EALLKSINDAKKIHLVPCHLREKFVLRFAICSRTVESTHIKFAWQHISQLATDLLKTWGQ
NHHQQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcagaattccgcaagagagggaaggagatggtggattatgttgcggattac
ctggagaagatagagaaacgccaggtattcccagatgtggagccagggtacctacggccc
ctcatcgcagactgtgcaccccaggatcctgagagcttcgaggatgtctttaaagacatt
gagaagatcattatgccaggggtgactcactggcacagtccgtacttttttgcctacttc
cctgcagcctgctccttcccagctcttcttgcagatatgttgtgtggtggaataggatgt
gtgggcttctcttgggctgcaagtccagcttgcacagagctggagactgtcatgctggat
tggctaggaaaaatggttaatttgcctgaagagtttttagctgggaaggatggccaaggt
ggaggagtcattcagggaagtgcaagcgaggccaccctgattgcactgcttgctgcaagg
acaaagactatcaaacaggtgcagtcagagaagcctgagctaacagaagcagagatcatg
ggcaggctggtggcttatgcttctgatcaggctcattcatctgtggaaagggcggcgcta
attggtgctgtgaagattaaaagtgttccttcagatgaaacatttagtgtttgtggttca
gccctgaagaaagttctggatgaagacaaagctgctggtcttataccattctttttctgt
gcaacacttggaaccaccccttgctgctcctttgacaagctgttagaactgggtcctatt
tgtaataaggaaaatatctggatgcatattgatgcagcctatgcgggaagtgcttttatc
tgccctgaattcaggcatcttttaaatggagtggagtttgcagattcatttaactttaat
cctcacaaatggctcctagtgaattttgactgctctgcaatgtgggtgaaaaaaagatca
gatttaataggggcctttaaattagaacctctttacctgcagcatcaccatcaggagtct
ggtcttgtaacagattatcggcactggcagatccccctgggcaggaggttccgctccctg
aagctctggttcgtgctgaggatgtacggggtcaaggggctgcaggagcacatccgcaag
cacatcagactgtcgcatcaatttgaacacttagtccttcaggatgagaggtttgagatc
tgtgctgaggttgtcctgggactggtctgcttccggctgaagggctcaaatgaactaaac
gaggcacttcttaaaagcataaatgatgccaagaagatccatctggtcccatgccacctg
cgagagaagtttgtgctacgttttgctatttgttcccgcacagtggaatccacccacatc
aagtttgcctggcagcacatctcacagctggcaactgatcttctgaaaacatgggggcaa
aaccaccaccagcagtaa

DBGET integrated database retrieval system