KEGG   Ficedula albicollis (collared flycatcher): 101811906Help
Entry
101811906         CDS       T02815                                 

Gene name
QDPR
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00790  Folate biosynthesis
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101811906 (QDPR)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     101811906 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short ALF
Motif
Other DBs
NCBI-GeneID: 101811906
NCBI-ProteinID: XP_005045486
Position
4
AA seq 187 aa AA seqDB search
MFLFYVLKVTAEVGKLLGEEKVDAILCVAGGWAGGSAKAKSLYKNCDLMWKQSVWTSTIS
SHLATKHLKEGGLLTLTGAQAALSGTPGMIAYGMAKGAVHQLCHSLAGASSGLPPGSAAV
AILPVTLDTPANRKAMPDADFSSWTPLEFIAETFYNWITGKDRPSSGSLIQVITTGGKTE
LVSAAHL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgttctatgtgttgaaggtgacagcagaagttggaaaacttcttggtgaagaa
aaggtggatgcaatcttgtgtgtagcaggaggatgggctggaggcagcgccaaagccaag
tctttatacaaaaactgtgatctgatgtggaagcagagtgtttggacatcgactatttcc
agccaccttgccacaaaacatctgaaagaagggggcctcttgacactgacaggagcccaa
gctgctttatctgggaccccagggatgattgcctatggcatggccaaaggagcagtgcat
cagctttgtcacagtttggctggtgccagcagtgggctgccacctggttctgctgcagtt
gccattttaccggttaccttagatacaccagcaaacaggaaagcaatgcctgatgcagat
ttcagctcctggacgcccttagaattcattgcagaaaccttttataactggataacagga
aaggatcgaccaagctctggcagtctaatccaggtgataactacaggtgggaagactgaa
cttgtttcagcagcacatctttga

DBGET integrated database retrieval system