KEGG   Ficedula albicollis (collared flycatcher): 101811931Help
Entry
101811931         CDS       T02815                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00562  Inositol phosphate metabolism
fab04012  ErbB signaling pathway
fab04068  FoxO signaling pathway
fab04070  Phosphatidylinositol signaling system
fab04140  Autophagy - animal
fab04150  mTOR signaling pathway
fab04210  Apoptosis
fab04218  Cellular senescence
fab04370  VEGF signaling pathway
fab04510  Focal adhesion
fab04620  Toll-like receptor signaling pathway
fab04625  C-type lectin receptor signaling pathway
fab04810  Regulation of actin cytoskeleton
fab04910  Insulin signaling pathway
fab04914  Progesterone-mediated oocyte maturation
fab04933  AGE-RAGE signaling pathway in diabetic complications
fab05164  Influenza A
Module
fab_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101811931 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101811931 (PIK3CD)
   04370 VEGF signaling pathway
    101811931 (PIK3CD)
   04068 FoxO signaling pathway
    101811931 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101811931 (PIK3CD)
   04150 mTOR signaling pathway
    101811931 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101811931 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    101811931 (PIK3CD)
   04218 Cellular senescence
    101811931 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101811931 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101811931 (PIK3CD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101811931 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101811931 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    101811931 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101811931 (PIK3CD)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101811931 (PIK3CD)
  Infectious diseases
   05164 Influenza A
    101811931 (PIK3CD)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101811931 (PIK3CD)
Membrane trafficking [BR:fab04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101811931 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 101811931
NCBI-ProteinID: XP_005057906
UniProt: U3JXY4
Position
21
AA seq 1046 aa AA seqDB search
MPPGIYCPSEFWSKGENQNIQVDFLLPTGIYLNLSVPCNASLGTIKQVLWQQAQYEPLFH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRAKKLINSQISLL
IGKGLHEFDSVQDPEVSDFRAKMCQFCEEKAAQRQQLGWAAWMEYNFPLQLEPMAKGLAP
GSQQIPTKNIFVNVKFQSGGESFTFQISPWEFPITLMSYAIKKQATVFRHETLQRPEDYT
LQVNGKCEYLYGNYPLCQFQHIRSCLQRGLTPHLTMVHSSAILAMRDEQNSCITSPPKAA
CKPPPLPKKKPNYGSLWSLEQPFYIELVQGSKVNADERMKLVVQAGLFHGHEMLCKTVSS
SEVSVCSEPVWRQRLRFEISVCDLPRMARLCLALYAVVEKARKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAALVICFPSVAA
HPVYYPSFEQLLELGRNGEQPRAAPEDSEEKLQLKEILERRSHTELYEHEKDLVWKMRFD
IRDQYPQALAKLLIITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFAI
NSLKKLTDDDVFQYLLQLVQVLKYESYLDCELTKFLLERALSNRKIGHFLFWHLRSEMHV
PAVALRFGLILEAYCRGSAHHMKVLMKQGEALNKMKALNDFVKVSSQKATKPQTKEMMHM
CMKQETYREALSHLQSPLNPNIILTEVCVDQCTFMDSKMKPLWIVFNNEETGGGGVGIIF
KNGDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVMHSDTVANIQ
LNKSNMVATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMVRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRG
YCERAYMILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRLK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaggcatttactgcccttccgaattctggtccaagggggagaaccaaaacatc
caggtggattttctgctgcccacagggatatacttgaacctctctgtgccctgcaatgcc
agcctgggcaccatcaagcaggtgctctggcagcaggcgcagtatgagccgctgttccac
atgctcagtgaccccgaggcctacgtgttcacctgcatcaaccagacggccgagcagcag
gagctggaggacgagcagcgccgcctctgcgacatccagcccttcctgcccgtgctgcgc
ctcgtggcgcgcgagggcgaccgggccaagaagctcatcaactcccagatcagcctgctc
atcggcaaaggcttgcacgagtttgactcggtgcaggaccccgaggtgagcgatttccgc
gccaagatgtgccagttctgcgaggagaaggcggcgcagcggcagcagctgggctgggca
gcctggatggagtacaacttccccctgcagctggagcccatggccaagggcctggcccct
ggctcgcagcagatccccaccaagaacatttttgtcaacgtcaagttccagtctggcggg
gagagcttcacgttccagatctccccctgggagttccccatcaccctgatgagctatgcc
atcaagaaacaggccactgtgttccgccacgagaccctgcagaggccagaggactacacc
ctgcaggtgaatgggaaatgtgaatatctctatggcaactaccccctgtgccagttccag
cacatccgcagctgcctgcagcggggcctgaccccccacctgaccatggtgcactcctct
gccatcctggccatgagggacgagcagaacagctgcatcaccagccccccaaaggcggcc
tgcaagccccccccgctccccaagaagaagccaaactatggctctctctggtccttagag
cagcctttctacatcgagctggtgcaaggcagcaaggtcaatgcagatgagagaatgaag
ctggtggtgcaggcggggctgttccacgggcacgagatgctgtgcaagacggtgtcgagc
tcggaggtgagcgtgtgctcggagcccgtgtggcggcagcggctgcgcttcgagatcagc
gtctgcgacctgccgcgcatggcgcgcctctgcctcgcgctctacgccgtggtcgagaag
gccaggaaggctcgctccaccaagaagaagtccaagaaagccgactgtcccatcgcctgg
gtcaacgtgatgctcttcgactacaaggaccagctgaagacaggggagtgctgcctgcac
atgtggtcctccttcccagatgagaaaggggaactcctgaaccccatgggcacagtgcag
tgcaaccccaacacggagagtgcagcagccttggtcatctgcttccccagcgtggcagca
catcctgtgtactacccatccttcgagcagctgctggagctgggaaggaatggagaacag
ccccgagctgcaccagaggattcagaggagaagctgcagctgaaggagatcctggagagg
aggagccacacggagctgtacgagcacgagaaggacctggtgtggaagatgaggtttgac
atccgggaccagtacccccaggctctggccaagctgctcatcatcaccaagtggaacaag
cacgaggacgtggcccagatgatttccctgcttcagacctggccagagctgcctgtcctg
aatgccttggagctgctggatttcagctttcctgaccgttacgttggctcctttgctatc
aactccctgaagaagctgacggatgatgatgtgttccagtacctgctgcagctggtccag
gtgctcaagtacgagtcctacctagactgcgaactgaccaagttcctgctggaaagggct
ttgtccaaccgcaagatcggccacttcctcttctggcacctcaggtcggagatgcacgtc
cccgccgtggcgctgcgcttcggcctgatcctggaggcgtactgccggggcagcgcccac
cacatgaaggtgctgatgaaacagggagaagcactgaacaagatgaaagctctgaatgac
tttgtgaaagtgagttctcagaaggccaccaagcctcaaaccaaggagatgatgcacatg
tgcatgaagcaggaaacctacagggaagccctttcccacctccagtcccccctgaacccc
aacattatcctcactgaagtctgtgtggatcagtgcaccttcatggactccaaaatgaaa
cctttgtggattgtgtttaataatgaagagacaggtggaggtggagtgggtataattttc
aaaaatggagatgatctgcgccaggacatgctgactctgcagatgatccagctgatggac
atcctgtggaagcaggagggcctggacctgaggatgaccccttatggctgcctctccaca
ggagacaggacggggctgatcgaggtggtcatgcactcggacaccgtcgccaacatccag
ctcaacaagagcaacatggtggccacggccgccttcaacaaggacgcgctgctcaactgg
ctcaagtccaagaacccgggagatgccttggagcaggccatcgaggagttcaccctgtcc
tgtgctgggtactgcgtggccacctacgtgctgggcattggggacaggcacagtgacaac
atcatggtcagggagacagggcagctgttccatattgattttggtcactttttggggaac
ttcaagactaaatttggtattaatagagaacgagtccctttcatcctaacctacgacttt
gtgcatgtcatccagcaaggaaaaaccaacaacaacgagaagtttgaaaggttcaggggt
tactgtgaacgagcctacatgatcctgcggcgccacgggctcctcttcctgcacctcttt
gcactgatgaaagctgctgggctgccggagctcagctgctccaaagacatccagtaccta
aaggactccctggcccttgggaaaacggatgaggaggcactgaagcacttcagactgaag
tttaatgaagccctgcgggagagctggaaaaccaaagtgaactggctggcacacaacgtg
tccaaagacaacaggcagtag

DBGET integrated database retrieval system