KEGG   Ficedula albicollis (collared flycatcher): 101812096Help
Entry
101812096         CDS       T02815                                 

Gene name
DUSP10
Definition
(RefSeq) dual specificity phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101812096 (DUSP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fab01009]
    101812096 (DUSP10)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101812096 (DUSP10)
    3.1.3.48  protein-tyrosine-phosphatase
     101812096 (DUSP10)
Protein phosphatases and associated proteins [BR:fab01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    101812096 (DUSP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 101812096
NCBI-ProteinID: XP_005043110
UniProt: U3KC19
Position
3
AA seq 481 aa AA seqDB search
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSFLESASSAGESHPGLLGAAVVSLKTANLTY
MPSSNGSARSLSCGCSSASCCTVATYDKDTQAQTQASASSAHAGAAPACPATQMVNSNES
AGSLSPLGGVGSPVSGSAKQLASIKIIYPNDLAKKMTKCSKSHQQNQGPVIIDCRPFMEY
NKSHIQGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIVVYDENTNEP
SRVMPSQPLHIVLESLKREGKEPLVLKGGLSGFKQNHENLCDNSLQLQECPEGGGGGGAA
AVPPVLPQSIPTTPDIENAELTPILPFLFLGNEHDAQDLEKMQRMNIGYVINVTTHLPLY
HYEKGMFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIA
YLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRIFTPKLIGVETV
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctcctttagacgacagggtagtagtggcactttcgaggccagtgagacct
caggatctcaacctgtgtttagactctagcttccttgaatctgcctcttctgctggtgag
agccaccccggtctgctcggcgcagctgtcgtgtccctaaagactgctaatctcacgtat
atgccctcatccaacggctctgcacgctccctgagttgtggatgcagcagtgccagttgc
tgcactgtggcaacgtacgacaaggacactcaggcccaaactcaagcgagcgccagcagc
gcccacgccggagccgcccccgcctgccctgccacccaaatggtcaacagcaatgagagc
gccggcagcctgagcccgctgggcggagtggggagccccgtctcgggcagcgccaagcag
ctcgccagcatcaaaatcatctaccccaacgacctggccaagaagatgaccaaatgcagc
aagagccaccaacagaaccaagggcctgtcatcattgactgcaggcccttcatggagtat
aataagagccacattcaaggggctgtccacattaactgttctgacaagatcagccggaga
aggctgcagcagggcaagatcaccgtcttggacttgatctcctgccgggaaggcaaggac
tccttcaagagaatcttttccaaagaaatcgtagtttatgatgagaataccaatgagcca
agcagagtgatgccttcccagccgctccacatagtgctagagtcactcaagcgagaaggc
aaggagcccctggtcctgaaaggaggactcagcgggttcaagcagaaccacgaaaacctc
tgcgacaactccctgcagctgcaggagtgccccgaggggggaggagggggcggcgccgcc
gccgtgccccccgtgctacctcagtccatccccaccacgcccgacatcgagaacgccgag
ctcacccccatcctgcccttcctcttcctcggaaacgagcacgacgcccaggacctggag
aagatgcagaggatgaacatcggctacgtcatcaacgtcaccacccacctgcccctgtac
cattacgagaagggcatgttcaactacaagcggctgcccgccactgacagcaacaagcag
aacctcaggcagtacttcgaagaggcttttgagttcattgaggaagctcatcagtgtgga
aaaggtctcctcatccactgccaggccggtgtgtcccgctctgccaccatcgttatcgcg
tacttaatgaagcacacacgcatgaccatgacggatgcctacaaatttgtcaaaggcaaa
cgaccaatcatttcccccaaccttaacttcatggggcagttactggagtttgaggaagac
ctgaacaatggagtgaccccgcgaatcttcacaccaaagctgatcggcgtggagactgtc
gtgtga

DBGET integrated database retrieval system