KEGG   Ficedula albicollis (collared flycatcher): 101812513Help
Entry
101812513         CDS       T02815                                 

Gene name
ERLIN1
Definition
(RefSeq) ER lipid raft associated 1
  KO
K23341  erlin
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fab04121]
    101812513 (ERLIN1)
Ubiquitin system [BR:fab04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101812513 (ERLIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 101812513
NCBI-ProteinID: XP_005048072
Position
6
AA seq 347 aa AA seqDB search
MAMAQAGAAAAAATGLLVFLLYSAIHRVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FKSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNKLAPHAVYDIVRNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKLALQKDLNVMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQRQKVVEKEAETDRKKALIEAEKAAQVARIHYQQKIMEKET
EKRISEIEDAAFLAREKAKADAEYYTARKLADSNKLKLTPEYLELMKYQAIAANSKLYFG
DRIPGVFLDSCAFQQASLRTAHETSLPAQESPESSAESPLRGEESTG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcccaggcgggggccgcggccgcggctgccacggggctcctcgtcttcctg
ctctactccgccatccacagggtcgaggagggacacctggccgtgtactacaggggcggc
gcgttgctgaccagcccgagcggccctggctaccacatcatgctccctttcatcaccacc
ttcaaatccgtgcagaccacgctgcagactgatgaagtgaagaacgtgccttgtgggaca
agtggtggtgttatgatctacattgaccgaatagaggttgtgaataagctggccccacat
gcagtgtacgacatcgtgaggaattacacagcagactacgacaagaccttgatcttcaac
aaaatccaccacgagctgaatcagttctgcagcgcccacaccctgcaggaggtgtacatc
gagctgtttgatcagatagatgagaacttgaagctggccctgcagaaagacctcaatgtc
atggcaccaggtctcactatccaggctgtgcgtgttacaaaacccaaaattccagaggcc
atccgaagaaattttgagctaatggaggctgagaagaccaagctgctgattgcagcccag
aggcagaaggtggtggagaaggaggcagagacagaccggaagaaagcgctcattgaggca
gagaaggctgcacaggtggccaggattcactaccaacagaagatcatggagaaggaaaca
gagaagcggatttctgagattgaagatgctgcattcctggcaagggagaaggcaaaagct
gatgcagagtactacactgctcggaagctggctgactccaacaagctgaagctgacccct
gagtatctggagctgatgaagtaccaggccatagctgccaacagcaagctgtacttcggc
gaccgcatccccggcgtgttcctggattcctgtgccttccagcaggccagcctgaggact
gcccacgaaaccagccttcctgcacaggaatccccagagagctctgcagaaagccccctc
agaggggaggagagcactggctga

DBGET integrated database retrieval system